NDEEEYEAWKVRELKRIKRDREDREALEKEKAEIERMRNLTEEERRAELRANGKVITNKAVKGKYKFLQKYYHRGAFFMD
EDEEVYKRDFSAPTLEDHFNKTILPKVMQVKNFGRSGRTKYTH
The query sequence (length=123) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8qo9:K | 212 | 123 | 1.0000 | 0.5802 | 1.0000 | 9.64e-88 | 7aav:K, 7abf:K, 7abg:K, 7abi:K, 8h6k:4K, 8q7n:K |
2 | 8swq:B | 278 | 23 | 0.0894 | 0.0396 | 0.4783 | 0.86 | 8swp:B, 8swq:E, 8swr:B, 8sws:B |
3 | 8swq:A | 302 | 23 | 0.0894 | 0.0364 | 0.4783 | 0.93 | 5ifk:A, 5ifk:B, 5ifk:C, 8swp:A, 8swp:D, 8swp:E, 8swq:D, 8swr:A, 8swr:D, 8sws:A, 8sws:D, 8sws:E |
4 | 4pfd:B | 410 | 45 | 0.1138 | 0.0341 | 0.3111 | 1.7 | 4p8m:B |
5 | 5u8t:2 | 583 | 52 | 0.1220 | 0.0257 | 0.2885 | 2.7 | |
6 | 2n8a:A | 214 | 70 | 0.1220 | 0.0701 | 0.2143 | 6.1 | 4av1:D, 4av1:B, 2l30:A, 2l31:A, 3od8:D, 3od8:F, 3oda:D, 3oda:F, 3odc:A, 3odc:B, 3ode:A, 3ode:B, 7s81:N, 7s81:A |
7 | 2cs2:A | 134 | 70 | 0.1220 | 0.1119 | 0.2143 | 9.7 |