NATEQETLTILLDVYAYYQAYQIVKASQFFSDDIIFLLELLKERRELNVDFLFQNQVHLQELELTYHISLLDNAYEEELL
ANYIMDLEAKLRNDHIIDFVRSVSPILYRLLMRLMQSQVADINDYIYDAKNDQYDTWKFDKMHDSANPFVQNFVAKGRDS
KITSRSLADFIQLTDLPQAIKDNILLLRDFEKSVRNPLAHLIKPFDEEELHRTTGFSSQTFLEKIIQLAVFSGIHYDNDK
FYFDKVNELIKRIYQ
The query sequence (length=255) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4rgp:A | 255 | 255 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 4rgp:B |
2 | 2cdq:A | 470 | 59 | 0.0784 | 0.0426 | 0.3390 | 0.50 | 2cdq:B |
3 | 2qt5:A | 194 | 62 | 0.0745 | 0.0979 | 0.3065 | 1.3 | 2qt5:B |
4 | 6wtb:B | 547 | 39 | 0.0510 | 0.0238 | 0.3333 | 4.1 | 8dd7:A, 4gu5:A, 4gu5:B, 4jzy:A, 4jzy:B, 4k03:A, 4k03:B, 7ud0:A, 7ud0:B, 6wtb:A |
5 | 4ac1:X | 283 | 132 | 0.1255 | 0.1131 | 0.2424 | 7.3 | |
6 | 3uh1:A | 367 | 25 | 0.0471 | 0.0327 | 0.4800 | 9.8 | 2qrj:A, 2qrk:A, 3uha:A, 3uha:B |
7 | 8om2:D | 341 | 63 | 0.0588 | 0.0440 | 0.2381 | 10.0 | 8d8l:D, 8om3:D, 8om4:D |