BioLiP

>protein
NAEASRVYEIIVESVVNEVREDFENAGIDEQTLQDLKNIWQKKLTETKVTTFSWDYLISPDENLMLCLYDKVTRTKARWK
CSLKDGVVTINRNDYTFQKAQVEAEWV

The query sequence (length=107) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5fmf:M	116	115	1.0000	0.9224	0.9304	6.14e-71	8cen:U, 8ceo:U, 7ml1:U, 7ml4:U, 1nh2:C, 7o4i:U, 7o4j:U, 7o72:U, 7o73:U, 7o75:U, 7oha:L, 5sva:d, 1ytf:C, 7zs9:U, 7zsa:U, 7zsb:U
2	7oh9:L	96	107	0.8972	1.0000	0.8972	2.13e-61	5fz5:U, 6gyl:U, 6gym:U
3	7egd:Q	101	103	0.3738	0.3960	0.3883	1.03e-24	7egj:Q
4	6mzm:W	90	103	0.3832	0.4556	0.3981	2.99e-24	7zwc:U, 7zwd:U, 7zxe:U
5	7edx:Q	122	121	0.4019	0.3525	0.3554	9.86e-23	8bvw:U, 7eg7:Q, 7eg9:Q, 7ega:Q, 7ena:DQ, 5fur:C, 8gxq:DQ, 8gxs:DQ, 5iy6:N, 5iy7:N, 5iy8:N, 5iy9:N, 5iya:N, 5iyb:N, 5iyc:N, 5iyd:N, 7lbm:M, 1nvp:C, 7nvr:U, 7nvs:U, 7nvt:U, 7nvu:U, 7nvy:U, 7nvz:U, 7nw0:U, 6o9l:N, 8s51:U, 8s5n:U, 8wak:Q, 8wal:Q, 8wan:Q, 8wao:Q, 8wap:Q, 8waq:Q, 8war:Q, 8was:Q
6	6iql:A	341	42	0.1495	0.0469	0.3810	0.85	6iql:B
7	6czy:A	362	40	0.0841	0.0249	0.2250	2.0	6czy:B, 6czy:C, 6czy:D, 6czz:A, 6czz:B, 6czz:C, 6czz:D
8	1k4w:A	244	25	0.1121	0.0492	0.4800	2.4	1n4h:A, 1nq7:A
9	6ny6:Y	84	41	0.1121	0.1429	0.2927	2.4	6otr:QY, 6otr:QZ, 6otr:XY, 6oxa:QY, 6oxa:QZ, 6oxa:XY, 6oxi:QY, 6oxi:QZ, 6oxi:XY, 4v8x:AY, 4v8x:AZ, 4v8x:CY, 4v8x:CZ
10	5ve9:C	74	32	0.1215	0.1757	0.4062	5.7
11	1jju:A	489	30	0.0935	0.0204	0.3333	6.2	1pby:A
12	5c79:A	104	44	0.1121	0.1154	0.2727	6.4	5c79:B
13	7pug:A	829	67	0.1495	0.0193	0.2388	8.6	7pxq:A

[Back]