BioLiP

>protein
NAAEVIVYEHVNFGGKSFDATSDQPGAGDNLNDKISSIKVKSGTWRFYEYINYGGRYWDLGPGEYSSVESAGIPDNSISS
FRQI

The query sequence (length=84) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2k1w:A	85	84	1.0000	0.9882	1.0000	6.40e-58	5ht9:A, 5ht9:B, 3hz2:A, 3hz2:B, 3hz2:C, 3hz2:D
2	2bv2:A	83	82	0.3571	0.3614	0.3659	6.71e-09	2bv2:B
3	4iau:A	161	77	0.2976	0.1553	0.3247	1.83e-08
4	4iau:A	161	53	0.2262	0.1180	0.3585	0.028
5	1prr:A	173	86	0.3214	0.1561	0.3140	2.16e-05	1nps:A, 1prs:A
6	1prr:A	173	36	0.1429	0.0694	0.3333	1.5	1nps:A, 1prs:A
7	3so1:H	89	38	0.2262	0.2135	0.5000	2.29e-05	5ht8:A, 3i9h:A, 3i9h:B, 3i9h:C, 3i9h:D, 3i9h:E, 3i9h:F, 3i9h:G, 3i9h:H, 3iaj:A, 3sny:A, 3snz:A, 3so0:A, 3so0:B, 3so0:C, 3so0:D, 3so0:E, 3so0:F, 3so0:G, 3so1:A, 3so1:B, 3so1:C, 3so1:D, 3so1:E, 3so1:F, 3so1:G
8	3so1:H	89	38	0.2143	0.2022	0.4737	0.003	5ht8:A, 3i9h:A, 3i9h:B, 3i9h:C, 3i9h:D, 3i9h:E, 3i9h:F, 3i9h:G, 3i9h:H, 3iaj:A, 3sny:A, 3snz:A, 3so0:A, 3so0:B, 3so0:C, 3so0:D, 3so0:E, 3so0:F, 3so0:G, 3so1:A, 3so1:B, 3so1:C, 3so1:D, 3so1:E, 3so1:F, 3so1:G
9	5ht7:A	82	79	0.3214	0.3293	0.3418	5.05e-04	5ht7:B, 5ht7:C
10	3hzb:D	90	37	0.1905	0.1778	0.4324	0.019	3hzb:A, 3hzb:B, 3hzb:C, 3hzb:E, 3hzb:F, 3hzb:G, 3hzb:H
11	1hdf:A	100	46	0.2262	0.1900	0.4130	0.046	1hdf:B
12	7ase:p	310	25	0.1429	0.0387	0.4800	3.1	5opt:p
13	3vu1:B	490	24	0.1310	0.0224	0.4583	4.1	3vu1:A
14	8sor:A	1156	29	0.1310	0.0095	0.3793	4.6
15	8khw:A	582	15	0.1190	0.0172	0.6667	5.9
16	5mps:N	227	44	0.1905	0.0705	0.3636	7.5	5lj3:N, 5lj5:N, 5mq0:N
17	4v8m:A7	314	24	0.1429	0.0382	0.5000	8.6	8ove:A7
18	2ejq:B	115	32	0.1429	0.1043	0.3750	9.3

[Back]