MYVCLCQGVTDNQIRVGTQCGKCASLAKQVVRE
The query sequence (length=33) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4e6k:H | 33 | 33 | 1.0000 | 1.0000 | 1.0000 | 2.38e-18 | |
2 | 4e6k:G | 57 | 51 | 1.0000 | 0.5789 | 0.6471 | 9.41e-14 | 4e6k:I, 6e6q:A, 6e6q:B, 6e6r:A, 6e6s:A, 6e6s:B |
3 | 2am1:A | 454 | 18 | 0.2727 | 0.0198 | 0.5000 | 5.2 | 2am2:A, 3zm5:A, 3zm6:A |