MYVCLCQGVTDNQIRDAIYEGCCSYREVREATGVGTQCGKCASLAKQVVRETLNDL
The query sequence (length=56) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 4e6k:G | 57 | 56 | 1.0000 | 0.9825 | 1.0000 | 4.86e-36 | 4e6k:I, 6e6q:A, 6e6q:B, 6e6r:A, 6e6s:A, 6e6s:B |
| 2 | 4e6k:H | 33 | 51 | 0.5893 | 1.0000 | 0.6471 | 1.43e-13 | |
| 3 | 8rbq:C | 477 | 18 | 0.1607 | 0.0189 | 0.5000 | 3.4 | 8ahx:C, 8rb8:C, 8rb9:C, 8rbm:C |
| 4 | 1on3:E | 520 | 31 | 0.2500 | 0.0269 | 0.4516 | 3.5 | 1on3:A, 1on3:D, 1on3:B, 1on3:C, 1on3:F, 1on9:A, 1on9:B, 1on9:C, 1on9:D, 1on9:E, 1on9:F |
zhanggroup.org