BioLiP

>protein
MVVQEGGYLAVLLGVLFPVAFLIILYIQSEARNAGMREAA

The query sequence (length=40) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4yuu:m2	40	40	1.0000	1.0000	1.0000	2.70e-22	4yuu:m1, 4yuu:M2
2	7y5e:ML	42	35	0.6250	0.5952	0.7143	1.46e-10	7y5e:m6, 7y7a:M9, 7y7a:ME, 7y7a:mO, 7y7a:mZ, 7y7a:Mm
3	8j5k:M	41	33	0.5250	0.5122	0.6364	2.89e-08	8j5k:m
4	8wb4:M	36	33	0.5000	0.5556	0.6061	5.83e-08	8wb4:m
5	8xlp:m	38	33	0.5250	0.5526	0.6364	6.10e-08
6	3a0b:M	36	35	0.4000	0.4444	0.4571	1.13e-04	3a0b:m, 3a0h:M, 3a0h:m, 5b66:M, 7d1u:M, 7d1u:m, 7dxh:m, 8f4f:m, 6jln:M, 6jlo:M, 6jlp:M, 5mx2:m, 1s5l:M, 1s5l:m, 5tis:M, 5v2c:M
7	8wql:MD	36	32	0.4000	0.4444	0.5000	1.26e-04	8wql:ME, 8wql:M1, 8wql:m1, 8wql:mD, 8wql:mE
8	8tow:M	31	29	0.3500	0.4516	0.4828	0.016	8tow:m
9	7ymi:M	31	30	0.3250	0.4194	0.4333	0.063	7ymi:m, 7ymm:1M, 7ymm:2M, 7ymm:3M, 7ymm:4M
10	5xnl:M	33	27	0.2250	0.2727	0.3333	0.33	7oui:M, 7oui:m, 5xnl:m, 5xnm:M, 5xnm:m
11	7pi5:M	32	26	0.2500	0.3125	0.3846	0.59	7pi5:m, 7pin:M, 7pin:m, 7pin:M1, 7pin:m1, 7piw:M, 7piw:m, 7piw:M1, 7piw:m1, 7pnk:M, 7pnk:m
12	8bd3:m	57	26	0.2250	0.1579	0.3462	0.67
13	7pu7:A	1070	21	0.2750	0.0103	0.5238	1.6	5lew:A
14	6kac:M	30	26	0.2250	0.3000	0.3462	1.8	6kac:m, 6kad:M, 6kad:m
15	3mi0:R	239	37	0.3500	0.0586	0.3784	2.8	2fhh:H, 2fhh:C, 2fhh:E, 2fhh:G, 2fhh:J, 2fhh:L, 2fhh:N, 2fhh:P, 2fhh:R, 2fhh:T, 2fhh:V, 2fhh:X, 2fhh:Z, 2fhh:2, 3krd:C, 3krd:E, 3krd:R, 3krd:G, 3krd:N, 3krd:H, 3krd:J, 3krd:L, 3krd:P, 3krd:V, 3krd:T, 3krd:X, 3krd:Z, 3krd:2, 3mi0:C, 3mi0:E, 3mi0:G, 3mi0:H, 3mi0:J, 3mi0:L, 3mi0:N, 3mi0:P, 3mi0:T, 3mi0:V, 3mi0:X, 3mi0:Z, 3mi0:2, 6ocw:H, 6ocw:I, 6ocw:J, 6ocw:K, 6ocw:L, 6ocw:M, 6ocw:N, 6ocw:V, 6ocw:W, 6ocw:X, 6ocw:Y, 6ocw:Z, 6ocw:a, 6ocw:b, 6ocz:H, 6ocz:I, 6ocz:J, 6ocz:K, 6ocz:L, 6ocz:M, 6ocz:N, 6ocz:V, 6ocz:W, 6ocz:X, 6ocz:Y, 6ocz:Z, 6ocz:a, 6ocz:b, 6ode:H, 6ode:I, 6ode:J, 6ode:K, 6ode:L, 6ode:M, 6ode:N, 6ode:V, 6ode:W, 6ode:X, 6ode:Y, 6ode:Z, 6ode:a, 6ode:b, 5tho:H, 5tho:I, 5tho:J, 5tho:K, 5tho:L, 5tho:M, 5tho:N, 5tho:V, 5tho:W, 5tho:X, 5tho:Y, 5tho:Z, 5tho:a, 5tho:b, 5trg:H, 5trg:I, 5trg:J, 5trg:K, 5trg:L, 5trg:M, 5trg:N, 5trg:V, 5trg:W, 5trg:X, 5trg:Y, 5trg:Z, 5trg:a, 5trg:b, 5trr:H, 5trr:I, 5trr:J, 5trr:K, 5trr:L, 5trr:M, 5trr:N, 5trr:V, 5trr:W, 5trr:X, 5trr:Y, 5trr:Z, 5trr:a, 5trr:b, 5trs:H, 5trs:I, 5trs:J, 5trs:K, 5trs:L, 5trs:M, 5trs:N, 5trs:V, 5trs:W, 5trs:X, 5trs:Y, 5trs:Z, 5trs:a, 5trs:b, 5try:H, 5try:I, 5try:J, 5try:K, 5try:L, 5try:M, 5try:N, 5try:V, 5try:W, 5try:X, 5try:Y, 5try:Z, 5try:a, 5try:b, 5ts0:H, 5ts0:I, 5ts0:J, 5ts0:K, 5ts0:L, 5ts0:M, 5ts0:N, 5ts0:V, 5ts0:W, 5ts0:X, 5ts0:Y, 5ts0:Z, 5ts0:a, 5ts0:b, 6wnk:H, 6wnk:I, 6wnk:J, 6wnk:K, 6wnk:L, 6wnk:M, 6wnk:N, 6wnk:V, 6wnk:W, 6wnk:X, 6wnk:Y, 6wnk:Z, 6wnk:a, 6wnk:b
16	6uij:A	620	31	0.2750	0.0177	0.3548	5.1	9cbf:A, 9cbg:A, 9cbi:A, 9cbj:A, 6uhv:A, 6uii:A, 6uil:A, 6uim:A
17	5ifp:A	968	32	0.3000	0.0124	0.3750	5.9	5ift:A, 5ihr:A, 5juv:A, 5mgc:A, 5mgd:A
18	4v4n:AO	197	22	0.2500	0.0508	0.4545	7.7	4v6u:BO
19	7sgg:A	644	16	0.1750	0.0109	0.4375	7.9	9cbh:A, 7kuq:A, 7kur:A, 7kus:A, 7kut:A, 7kuv:A, 7sgi:A, 7sgj:A, 7sgk:A, 5td7:A, 7u3m:A, 7u59:A, 7u69:A, 7u6a:A, 7u6b:B, 6ufn:A, 6ufo:A, 6uhu:A, 6vnq:A, 6wbq:A, 6wdv:A, 6wdw:A, 6wdx:A, 6wdy:A
20	6skf:BQ	164	22	0.2500	0.0610	0.4545	9.2	6skg:BQ, 6th6:BQ

[Back]