MVALKGIPKVLSPELLFALARMGHGDEIVLADANFPTSSICQCGPVEIRADGLDIPQLLEAVLRLLPLDTYVESPAAVMD
LVPSDKEKGLQTPIWKRYESLLLEADCKKTLMKLERFEFYERAKKAFAVVATGEMALYGNIILKKGTLD
The query sequence (length=149) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2wcu:A | 149 | 149 | 1.0000 | 1.0000 | 1.0000 | 2.11e-107 | 2wcu:B |
2 | 4a34:I | 142 | 147 | 0.5034 | 0.5282 | 0.5102 | 9.85e-44 | 4a34:A, 4a34:B, 4a34:C, 4a34:D, 4a34:E, 4a34:F, 4a34:G, 4a34:H, 4a34:J, 4a34:K, 4a34:O, 4a34:L, 4a34:M, 4a34:N, 4a34:P, 4a34:Q, 4a34:R, 4a34:S, 4a34:T |
3 | 2wcv:B | 140 | 145 | 0.4832 | 0.5143 | 0.4966 | 6.57e-37 | 2wcv:A, 2wcv:C, 2wcv:D, 2wcv:E, 2wcv:F, 2wcv:G, 2wcv:H, 2wcv:I, 2wcv:J |
4 | 1ogd:A | 131 | 142 | 0.3087 | 0.3511 | 0.3239 | 3.62e-05 | 1ogd:B, 1ogd:C, 1ogd:D, 1ogd:E, 1oge:A, 1oge:B, 1oge:C, 1oge:D, 1oge:E |
5 | 6ywe:L | 192 | 75 | 0.1544 | 0.1198 | 0.3067 | 0.29 | 6yws:L, 6ywv:L, 6ywx:L, 6ywy:L |
6 | 7va8:A | 456 | 59 | 0.1208 | 0.0395 | 0.3051 | 0.46 | 7va8:B, 7vaa:A, 7vaa:B |
7 | 1gws:A | 503 | 122 | 0.2013 | 0.0596 | 0.2459 | 3.3 | 2cvc:A, 1h29:A, 1h29:B, 1h29:C, 1h29:D |
8 | 3on0:A | 121 | 59 | 0.1074 | 0.1322 | 0.2712 | 8.0 | 3omy:B, 3on0:B, 3on0:C, 3on0:D |