MTTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMPLKMQSAEGGIEFDADGGVSIGPEFRALEGAWAEGVV
AMARAGARIIIDDVFLGGAAAQERWRSFVGDLDVLWVGVRCDGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVDT
THKESIECAWAIAAHVVP
The query sequence (length=178) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1grq:A | 178 | 178 | 1.0000 | 1.0000 | 1.0000 | 5.12e-127 | 1grr:A, 1qhn:A, 1qhs:A, 1qhx:A, 1qhy:A |
2 | 1zny:A | 183 | 39 | 0.0899 | 0.0874 | 0.4103 | 0.020 | 1znx:A, 1znz:A |
3 | 5u30:A | 1085 | 142 | 0.1966 | 0.0323 | 0.2465 | 0.40 | 5u31:A, 5u33:A |
4 | 2xsp:A | 440 | 44 | 0.0899 | 0.0364 | 0.3636 | 4.4 | 2yg1:A, 2yg1:B |
5 | 3vkg:B | 2853 | 43 | 0.0899 | 0.0056 | 0.3721 | 6.4 | |
6 | 3vkh:B | 2908 | 43 | 0.0899 | 0.0055 | 0.3721 | 6.4 | |
7 | 3vkg:A | 2954 | 43 | 0.0899 | 0.0054 | 0.3721 | 6.4 | |
8 | 3vkh:A | 3042 | 43 | 0.0899 | 0.0053 | 0.3721 | 6.4 | |
9 | 6zns:A | 635 | 44 | 0.0899 | 0.0252 | 0.3636 | 7.6 | |
10 | 6znq:B | 711 | 44 | 0.0899 | 0.0225 | 0.3636 | 7.7 | 6znp:B |
11 | 6znp:A | 748 | 44 | 0.0899 | 0.0214 | 0.3636 | 7.7 | 6znq:A |