MTPTIELICGHRSIRHFTDEPISEAQREAIINSARATSSSSFLQCSSIIRITDKALREELVTLTGGQKHVAQAAEFWVFC
ADFNRHLQICPDAQLGLAEQLLLGVVDTAMMAQNALIAAESLGLGGVYIGGLRNNIEAVTKLLKLPQHVLPLFGLCLGWP
ADNPDLKPRLPASILVHENSYQPLDKGALAQYDEQLAEYYLTRNRRDTWSDHIRRTIIKESRPFILDYLHKQGWATR
The query sequence (length=237) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8ajx:A | 240 | 240 | 1.0000 | 0.9875 | 0.9875 | 1.23e-177 | 1f5v:A, 1f5v:B, 7nb9:A, 7niy:A, 7nmp:A, 7nnx:A, 7q0o:A, 7z0w:A, 7z0w:B, 7z0w:C, 7z0w:D, 7z0w:E, 7z0w:F, 7z0w:G, 7z0w:H |
2 | 5uu6:C | 236 | 237 | 0.5148 | 0.5169 | 0.5148 | 6.63e-86 | 5uu6:A, 5uu6:B, 5uu6:D |
3 | 1bkj:A | 230 | 234 | 0.5063 | 0.5217 | 0.5128 | 1.48e-81 | 1bkj:B, 2bkj:A, 2bkj:B |
4 | 5hdj:B | 248 | 246 | 0.4599 | 0.4395 | 0.4431 | 3.40e-72 | 5hdj:A |
5 | 3n2s:A | 248 | 243 | 0.4135 | 0.3952 | 0.4033 | 5.78e-62 | 3n2s:B, 3n2s:C, 3n2s:D |
6 | 1zch:A | 249 | 245 | 0.3966 | 0.3775 | 0.3837 | 8.58e-48 | |
7 | 5hei:A | 246 | 243 | 0.4051 | 0.3902 | 0.3951 | 1.31e-44 | 5hei:B, 5hei:C, 5hei:D, 5hei:E, 5hei:F, 5hei:G, 5hei:H |
8 | 3eof:A | 248 | 247 | 0.2827 | 0.2702 | 0.2713 | 6.39e-21 | 3eof:B |
9 | 4dn2:A | 191 | 194 | 0.2194 | 0.2723 | 0.2680 | 5.59e-15 | 4dn2:B |
10 | 3m5k:A | 168 | 159 | 0.1941 | 0.2738 | 0.2893 | 3.47e-13 | 3m5k:B |
11 | 3kwk:A | 168 | 180 | 0.1688 | 0.2381 | 0.2222 | 3.65e-10 | |
12 | 4g8s:A | 182 | 179 | 0.1899 | 0.2473 | 0.2514 | 1.08e-09 | 4g8s:B |
13 | 3ge5:A | 176 | 158 | 0.1519 | 0.2045 | 0.2278 | 1.19e-05 | 3ge5:B |
14 | 3of4:A | 208 | 68 | 0.1055 | 0.1202 | 0.3676 | 4.55e-04 | 3of4:B, 3of4:C |
15 | 3koq:A | 173 | 180 | 0.1561 | 0.2139 | 0.2056 | 7.09e-04 | 3h4o:A, 3koq:B, 3koq:C, 3koq:D |
16 | 1nox:A | 200 | 74 | 0.0970 | 0.1150 | 0.3108 | 0.001 | |
17 | 8cqt:B | 164 | 178 | 0.1688 | 0.2439 | 0.2247 | 0.002 | 8cqt:A |
18 | 3gfa:A | 197 | 191 | 0.1857 | 0.2234 | 0.2304 | 0.009 | 3gfa:B |
19 | 3gr3:A | 226 | 214 | 0.2236 | 0.2345 | 0.2477 | 0.069 | 3gr3:B |
20 | 3e39:A | 175 | 184 | 0.1899 | 0.2571 | 0.2446 | 0.071 | 3e39:B |
21 | 2isj:A | 219 | 201 | 0.1941 | 0.2100 | 0.2289 | 0.097 | 2isj:B, 2isj:C, 2isj:D, 2isj:E, 2isj:F, 2isj:G, 2isj:H, 2isk:A, 2isk:B, 2isk:C, 2isk:D, 2isk:E, 2isk:F, 2isk:G, 2isk:H, 2isl:A, 2isl:B, 2isl:C, 2isl:D, 2isl:E, 2isl:F, 2isl:G, 2isl:H |
22 | 8ep6:A | 245 | 54 | 0.0675 | 0.0653 | 0.2963 | 0.15 | |
23 | 6a7w:A | 324 | 129 | 0.1266 | 0.0926 | 0.2326 | 0.52 | 6a7w:B, 5mx9:A, 6sut:A |
24 | 4xoq:A | 204 | 87 | 0.1224 | 0.1422 | 0.3333 | 0.93 | 4xoo:A, 4xoo:B, 4xoo:C, 4xoo:D, 4xoq:B, 4xoq:C, 4xoq:D |
25 | 7jh4:A | 223 | 90 | 0.1097 | 0.1166 | 0.2889 | 1.2 | 7jh4:B, 7jh4:C, 7jh4:D, 7jh4:E |
26 | 2wtk:B | 311 | 145 | 0.1392 | 0.1061 | 0.2276 | 1.9 | 3gni:B, 8vsu:B, 2wtk:E |
27 | 7ry3:C | 1048 | 171 | 0.1688 | 0.0382 | 0.2339 | 4.6 | 7m4p:B |
28 | 4g9b:A | 227 | 60 | 0.0886 | 0.0925 | 0.3500 | 5.9 | |
29 | 7blz:B | 731 | 43 | 0.0759 | 0.0246 | 0.4186 | 6.4 | 6fos:B, 8wey:B, 5zgb:B, 5zgh:B |
30 | 7ckf:A | 256 | 128 | 0.1392 | 0.1289 | 0.2578 | 7.7 | 7ckf:B |
31 | 8c4t:A | 1268 | 70 | 0.0717 | 0.0134 | 0.2429 | 9.7 | |
32 | 7dp0:A | 223 | 39 | 0.0591 | 0.0628 | 0.3590 | 9.7 | 7dp0:B, 7dp1:A, 7dp1:B, 7dp2:A, 7dp2:B |