MTPSLSAFINSLLLGLFVVVIPIGAALFLVSQSDRVTRT
The query sequence (length=39) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8wb4:X | 39 | 39 | 1.0000 | 1.0000 | 1.0000 | 4.71e-21 | 8wb4:x, 8xr6:X, 8xr6:x |
2 | 8xlp:x | 36 | 36 | 0.7179 | 0.7778 | 0.7778 | 2.93e-14 | 8xlp:X |
3 | 7n8o:X | 38 | 38 | 0.4872 | 0.5000 | 0.5000 | 1.39e-07 | 7n8o:x, 7rcv:X, 7rcv:x, 8tow:X, 8tow:x, 6wj6:X |
4 | 8wql:XD | 40 | 38 | 0.4615 | 0.4500 | 0.4737 | 6.42e-07 | 8wql:XE, 8wql:X1, 8wql:x1, 8wql:xD, 8wql:xE |
5 | 7vd5:X | 37 | 38 | 0.5385 | 0.5676 | 0.5526 | 3.02e-04 | 6jlu:X, 6jlu:x, 7vd5:x |
6 | 2ve3:A | 435 | 33 | 0.3077 | 0.0276 | 0.3636 | 5.7 | 2ve3:B, 2ve4:A, 2ve4:B |
7 | 6ru1:B | 386 | 14 | 0.2308 | 0.0233 | 0.6429 | 6.0 | 6ru2:A, 6ru2:B, 6rv7:B, 6rv8:B, 6rv8:A, 6rv9:B |
8 | 8g27:I | 720 | 21 | 0.2308 | 0.0125 | 0.4286 | 9.5 | 8g27:C, 8g27:D, 8g2j:C, 8g2j:D, 8g2j:I, 6wlb:A, 6wlb:C, 6wlb:B |