BioLiP Library

>protein
MTPSLANFLWSLVLGAAIVLIPATVGLIFISQKDKITR

The query sequence (length=38) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7n8o:X	38	38	1.0000	1.0000	1.0000	2.58e-21	7n8o:x, 7rcv:X, 7rcv:x, 8tow:X, 8tow:x, 6wj6:X
2	8wql:XD	40	38	0.7105	0.6750	0.7105	2.52e-14	8wql:XE, 8wql:X1, 8wql:x1, 8wql:xD, 8wql:xE
3	8wb4:X	39	38	0.5000	0.4872	0.5000	1.36e-07	8wb4:x, 8xr6:X, 8xr6:x
4	7vd5:X	37	38	0.4737	0.4865	0.4737	1.09e-04	6jlu:X, 6jlu:x, 7vd5:x
5	8xlp:x	36	36	0.4211	0.4444	0.4444	1.19e-04	8xlp:X
6	4il6:X	40	38	0.4474	0.4250	0.4474	0.057	3a0b:X, 3a0b:x, 5b5e:X, 5b5e:x, 5b66:X, 5b66:x, 7d1t:X, 7d1t:x, 7d1u:X, 7d1u:x, 6dhe:X, 6dhf:X, 6dhh:X, 6dho:X, 6dhp:X, 5e79:X, 5e7c:X, 5e7c:x, 7eda:X, 8ez5:X, 8ez5:x, 8f4d:X, 8f4d:x, 8f4e:X, 8f4f:X, 8f4f:x, 8f4g:X, 8f4h:X, 8f4i:X, 8f4i:x, 8f4j:X, 8f4j:x, 8f4k:X, 8gn0:x, 8gn1:x, 8gn2:x, 5h2f:X, 5h2f:x, 4il6:x, 8ir5:X, 8ir6:x, 8ir8:x, 8ira:X, 8irc:x, 8ird:x, 8ire:x, 8irf:x, 8iri:X, 8iri:x, 4ixr:X, 6jlj:X, 6jlj:x, 6jlk:X, 6jlk:x, 6jll:x, 6jlm:x, 6jln:X, 6jln:x, 6jlp:X, 6jlp:x, 5kaf:X, 5kai:X, 5kai:x, 3kzi:X, 5mx2:x, 4pbu:X, 4pbu:x, 7rf1:x, 7rf2:X, 7rf3:X, 7rf4:X, 7rf4:x, 7rf5:X, 7rf6:X, 7rf7:X, 7rf8:X, 7rf8:x, 4rvy:X, 4rvy:x, 5tis:x, 4ub6:X, 4ub8:X, 5v2c:X, 5v2c:x, 4v62:AX, 4v62:BX, 6w1o:X, 6w1o:x, 6w1p:X, 6w1r:X, 6w1t:X, 6w1u:X, 6w1v:X, 6w1v:x, 3wu2:X, 3wu2:x, 7yq2:X, 7yq2:x, 7yq7:x, 5zzn:x
7	7pi0:X	30	18	0.3158	0.4000	0.6667	0.12	7pi0:x, 7pi5:X, 7pi5:x, 7pin:X, 7pin:X1, 7pin:x1, 7piw:X, 7piw:x, 7piw:x1, 7pnk:X, 7pnk:x
8	6kaf:x	35	19	0.2895	0.3143	0.5789	0.14	6kaf:X, 8kde:X, 8zee:X
9	5xnl:X	39	39	0.4211	0.4103	0.4103	0.39	5xnl:x
10	8rqf:A	301	28	0.2368	0.0299	0.3214	2.9	7zyi:A
11	5egp:A	282	31	0.3684	0.0496	0.4516	3.5	5egp:B, 5jgk:A, 5jgk:B, 5jgl:A, 5jgl:B
12	8i34:A	175	30	0.3684	0.0800	0.4667	4.0	8i34:C, 8i34:E, 8i34:G
13	7r0h:A	654	23	0.2368	0.0138	0.3913	4.3	3a1c:A, 3a1c:B, 3a1d:A, 3a1d:B, 3a1e:A, 3a1e:B

[Back]