MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIIQFLNQIKEDIQSIEKYPYEYHHFQSDRR
The query sequence (length=279) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
3acw:A |
284 |
284 |
1.0000 |
0.9824 |
0.9824 |
0.0 |
3acx:A, 3acy:A, 3adz:A, 3ae0:A, 3ae0:B, 4e9u:A, 4e9z:A, 4ea0:A, 4ea0:B, 4ea1:A, 4ea2:A, 4f6v:A, 4f6x:A, 3lgz:B, 3npr:A, 3nri:A, 3tfn:A, 3tfp:A, 3tfv:A, 3vje:A, 3vje:B, 3w7f:A, 3w7f:B, 2zcq:A, 2zcr:A, 2zcs:A, 2zy1:A |
2 |
8is7:A |
275 |
272 |
0.3297 |
0.3345 |
0.3382 |
7.58e-46 |
8is8:A, 8is9:A, 8isa:A |
3 |
5iys:A |
283 |
273 |
0.3154 |
0.3110 |
0.3223 |
7.41e-41 |
|
4 |
3asx:A |
335 |
213 |
0.1828 |
0.1522 |
0.2394 |
8.40e-07 |
1ezf:A, 1ezf:B, 1ezf:C, 3lee:A, 3lee:B, 3lee:C, 3lee:D, 3lee:E, 3q2z:A, 3q30:A, 3v66:A, 3vj9:A, 3vjc:A, 3vjc:B, 3vjc:C, 3vjc:D, 3vjc:E, 3vjc:F, 3wc9:A, 3wc9:B, 3wc9:C, 3wc9:D, 3wc9:E, 3wc9:F, 3wcd:A, 3wcd:B, 3wcd:D, 3wcd:E, 3wcf:A, 3wcf:B, 3wcf:C, 3wcf:D, 3wcf:E, 3wcf:F, 3wch:A, 3wch:B, 3wch:C, 3wch:D, 3wch:E, 3wch:F, 3wci:A, 3wci:B, 3wci:C, 3wci:D, 3wci:E, 3wci:F, 3wcj:A, 3wcj:B, 3wcj:C, 3wcj:D, 3wcj:E, 3wcj:F, 3wcl:A, 3wcm:A, 3wcm:B, 3wcm:C, 3wcm:D, 3wcm:E, 3wcm:F, 3wef:A, 3wef:B, 3wef:C, 3wef:D, 3wef:E, 3weg:A, 3weh:A, 3wei:A, 3wej:A, 3wek:A, 3wsa:A, 3wsa:B, 3wsa:C, 3wsa:E, 8wtq:A, 8wtr:A |
5 |
3wcc:C |
342 |
210 |
0.1756 |
0.1433 |
0.2333 |
4.67e-06 |
3wca:A, 3wca:B, 3wca:C, 3wca:D, 3wcb:A, 3wcb:B, 3wcb:D, 3wcc:A, 3wcc:B, 3wcc:D, 3wce:A, 3wce:B, 3wce:C, 3wce:D, 3wcg:A, 3wcg:B, 3wcg:C, 3wcg:D, 3wsb:A, 3wsb:B, 3wsb:C, 3wsb:D |
6 |
7wgh:A |
350 |
78 |
0.0932 |
0.0743 |
0.3333 |
2.35e-05 |
7wgi:A |
7 |
3lee:F |
262 |
187 |
0.1613 |
0.1718 |
0.2406 |
0.002 |
|
8 |
8snb:8F |
265 |
41 |
0.0573 |
0.0604 |
0.3902 |
0.17 |
|
9 |
5u23:D |
366 |
46 |
0.0573 |
0.0437 |
0.3478 |
0.67 |
5u21:A, 5u21:B, 5u21:C, 5u21:D, 5u23:C, 5u23:A, 5u23:B, 5u24:A, 5u24:B, 5u24:C, 5u24:D |
10 |
6exn:a |
171 |
57 |
0.0538 |
0.0877 |
0.2632 |
0.75 |
6bk8:N |
11 |
8vsi:B |
579 |
95 |
0.0824 |
0.0397 |
0.2421 |
0.78 |
|
12 |
4o98:B |
307 |
33 |
0.0394 |
0.0358 |
0.3333 |
1.6 |
4o98:A |
13 |
5yhw:A |
453 |
84 |
0.0717 |
0.0442 |
0.2381 |
6.0 |
5yhw:B, 5yhw:C, 5yhw:F |