MTAESMLANGAFIMIGLTLLGLAWGFVIIKLQGS
The query sequence (length=34) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 7zxy:F | 36 | 34 | 1.0000 | 0.9444 | 1.0000 | 1.49e-17 | 7r0w:N, 7r0w:F, 7zxy:N |
| 2 | 1q90:M | 34 | 26 | 0.3529 | 0.3529 | 0.4615 | 0.008 | |
| 3 | 7zyv:F | 37 | 24 | 0.3235 | 0.2973 | 0.4583 | 0.038 | 7qrm:F, 7qrm:N, 6rqf:N, 6rqf:F, 7zyv:N |
| 4 | 7wic:R | 288 | 21 | 0.2353 | 0.0278 | 0.3810 | 9.4 | 7t10:R, 7t11:R, 7wig:R, 7wj5:R, 7xat:A, 7xau:A, 7xav:A, 7xmr:R, 7y24:E, 7y26:E, 7y27:E, 7yac:E, 7yae:E |
umich.edu