BioLiP

>protein
MSSTQDRSQLDPEVDVEDVPSAEWGWSHMPIGVMHIGGLLSAAFLLVMMRGNHVGHVEDWFLIGFAAVIVALVGRNWWLR
RRGWIR

The query sequence (length=86) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6adq:D	92	92	1.0000	0.9348	0.9348	1.23e-55	6adq:P, 8ovc:P, 8ovc:I, 8ovd:P, 8ovd:I, 7rh5:P, 7rh5:J, 7rh6:J, 7rh6:P, 7rh7:P, 7rh7:J
2	7qhm:I	135	69	0.2907	0.1852	0.3623	7.23e-07	7q21:H, 7q21:h, 7qhm:V, 7qho:I, 7qho:V
3	6tvk:AAA	660	27	0.0814	0.0106	0.2593	2.4
4	7dva:A	523	23	0.1279	0.0210	0.4783	3.3	7dva:B, 7dvb:A, 7dvb:B, 7dvb:C, 7dvb:D
5	6ko5:A	398	16	0.1047	0.0226	0.5625	4.2	7f9y:R, 7f9z:R, 7na7:R, 7na8:R, 7w2z:R
6	8h6k:5B	2253	23	0.1163	0.0044	0.4348	4.8	8h6l:5B, 8i0u:A, 8i0v:A, 8q7n:A, 8qo9:A, 8qpe:A, 7qtt:a, 8qzs:A
7	5z56:A	2232	23	0.1163	0.0045	0.4348	4.9	7aav:A, 7abf:A, 8ch6:a, 7dvq:A, 8i0s:A, 5z58:A
8	8adl:B	801	19	0.1047	0.0112	0.4737	4.9	8adl:G, 8adl:O, 8adl:J
9	5z57:A	1978	23	0.1163	0.0051	0.4348	5.0
10	8i0p:A	2149	23	0.1163	0.0047	0.4348	5.0	8q7q:A, 8q7v:A, 8q7w:A
11	7abg:A	2174	23	0.1163	0.0046	0.4348	5.0	7abi:A, 8q91:A, 8rc0:A
12	8y6o:C	2227	23	0.1163	0.0045	0.4348	5.0	8h6e:5B, 8h6j:5B, 8qp9:A, 6qw6:5A, 6qx9:5A, 8qxd:A, 8r08:A
13	8c6j:A	2261	23	0.1163	0.0044	0.4348	5.0	6ah0:A, 6ahd:A, 8bc8:J, 6ff4:A, 6ff7:A, 9fmd:A, 8i0r:A, 8i0t:A, 8i0w:A, 6icz:A, 6id0:A, 6id1:A, 4jk9:A, 4jk9:B, 4jka:A, 4jka:B, 5mqf:A, 5o9z:A, 6qdv:A, 8qoz:A, 8qpa:A, 8qpb:A, 8qpk:A, 8r09:A, 8r0a:A, 8r0b:A, 8rm5:A, 8ro2:A, 7w59:A, 7w5a:A, 7w5b:A, 5xjc:A, 5yzg:A, 6zym:A
14	8q7x:A	1914	23	0.1163	0.0052	0.4348	5.3
15	8qp8:A	1918	23	0.1163	0.0052	0.4348	5.3
16	4ptv:A	445	23	0.1279	0.0247	0.4783	7.4	4ptv:B, 4ptw:A, 4ptw:B, 4ptx:A, 4ptx:B

[Back]