MSFPPQRYHYFLVLDFEATCDKPQIHPQEIIEFPILKLNGRTMEIESTFHMYVQPVVHPQLTPFCTELTGIIQAMVDGQP
SLQQVLERVDEWMAKEGLLDPNVKSIFVTCGDWDLKVMLPGQCQYLGLPVADYFKQWINLKKAYSFAMGCWPKNGLLDMN
KGLSLQHIGRPHSGIDDCKNIANIMKTLAYRGFIFKQTSK
The query sequence (length=200) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2xri:A | 206 | 200 | 0.9950 | 0.9660 | 0.9950 | 8.88e-150 | 7k05:A, 7k05:B, 7k06:A, 7k06:B, 7k07:A, 7k07:B, 7lpy:A, 7lpy:B, 7lpz:A, 7lpz:B, 7lq0:A, 7lq0:B |
2 | 1zbu:B | 304 | 186 | 0.3850 | 0.2533 | 0.4140 | 2.01e-38 | 4l8r:B, 4l8r:E, 4qoz:B, 4qoz:E, 1w0h:A, 1zbh:A, 1zbh:D, 1zbh:B, 1zbh:C, 1zbu:A, 1zbu:C, 1zbu:D |
3 | 7n8w:A | 214 | 209 | 0.3800 | 0.3551 | 0.3636 | 1.51e-33 | 7n8w:B |
4 | 3cg7:A | 296 | 194 | 0.3100 | 0.2095 | 0.3196 | 3.31e-21 | 3cg7:B, 3cm5:A, 3cm5:B, 3cm6:A, 3cm6:B, 5dk5:A, 5dk5:B |
5 | 3rpc:A | 262 | 93 | 0.1400 | 0.1069 | 0.3011 | 0.20 | 3rpc:B, 3rpc:C, 3rpc:D |
6 | 4pne:B | 272 | 57 | 0.0900 | 0.0662 | 0.3158 | 0.47 | 4pne:A |
7 | 4r43:A | 601 | 29 | 0.0750 | 0.0250 | 0.5172 | 1.1 | 5i67:A, 4rcg:A, 4wie:A, 4wiu:A, 4wl8:A, 4wou:A, 4wpt:A, 4wpu:A, 4wpv:A |
8 | 6sc2:B | 3930 | 59 | 0.0800 | 0.0041 | 0.2712 | 2.1 | 6rla:A, 6rla:B, 6sc2:A |
9 | 4rh7:A | 3005 | 59 | 0.0800 | 0.0053 | 0.2712 | 2.2 | |
10 | 7e1n:A | 210 | 31 | 0.0600 | 0.0571 | 0.3871 | 3.3 | 7e1n:B |
11 | 7v55:A | 781 | 65 | 0.0950 | 0.0243 | 0.2923 | 5.0 | |
12 | 3ug4:C | 484 | 67 | 0.0900 | 0.0372 | 0.2687 | 5.8 | 3ug4:A, 3ug4:B, 3ug4:D, 3ug4:E, 3ug4:F, 3ug5:A, 3ug5:B, 3ug5:C, 3ug5:D, 3ug5:E, 3ug5:F |
13 | 6nt2:A | 330 | 31 | 0.0550 | 0.0333 | 0.3548 | 7.4 | 6nt2:D, 6nt2:B, 6nt2:C, 1or8:A, 1orh:A, 1ori:A, 3q7e:A |
14 | 8yeo:A | 255 | 44 | 0.0750 | 0.0588 | 0.3409 | 7.5 | 8w1p:H, 8ydb:A, 8yh9:A |
15 | 3lli:A | 251 | 59 | 0.0650 | 0.0518 | 0.2203 | 7.7 | 3llk:A, 3llk:B, 3llk:C |