BioLiP

>protein
MRPLTHEETKTFFEKLAQYIGKNITHLIDRPDDPHCFRLQKDRVYYVSERAMKMATSVARQNLMSLGICFGKFTKTNKFR
LHITALDYIAQYARYKIWVKSNGEMPFLYGNHVLKAHVGRITDDTPQHQGVVIYSMNDTPLGFGVTARSTLELRRLEPTA
IVAFHQADVGEYLR

The query sequence (length=174) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8esq:l	174	174	1.0000	1.0000	1.0000	1.01e-132	8esr:l
2	7nac:l	176	174	0.6954	0.6875	0.6954	6.18e-94	6elz:l, 6em5:l, 7ohr:l, 7r6k:l, 7r7a:l, 7r7c:l, 8v83:l, 8v84:l, 8v87:l
3	8fkt:NH	180	174	0.6437	0.6222	0.6437	1.52e-88	8fku:NH, 8fkv:NH, 8fkw:NH, 8fkx:NH, 8fky:NH
4	8i9r:CG	177	176	0.6149	0.6045	0.6080	3.20e-74	8i9t:CG, 8i9v:CG, 8i9w:CG, 8i9x:CG, 8i9y:CG, 8i9z:CG, 8ia0:CG
5	5x4j:A	471	78	0.1322	0.0488	0.2949	1.4	5x4h:A, 5x4i:A, 5x4k:A
6	3hch:A	145	33	0.0632	0.0759	0.3333	2.4	3hch:B
7	7e43:B	324	31	0.0690	0.0370	0.3871	2.6	7e43:A
8	7aoi:BI	323	56	0.0862	0.0464	0.2679	2.9	6hiv:BI, 6hix:BI, 6yxx:BI, 6yxy:BI
9	7xx4:A	395	48	0.0862	0.0380	0.3125	2.9	2iyf:A, 2iyf:B, 4m83:A, 4m83:B, 7xx4:B
10	2xa7:M	428	60	0.1092	0.0444	0.3167	3.6	5c7z:A, 5fpi:A, 7oiq:AAA, 7oit:AAA, 6qh6:M, 6qh7:M, 8t1o:M, 5wrl:A, 5wrm:A, 6yaf:M
11	7og1:MMM	406	60	0.1092	0.0468	0.3167	3.8	6bnt:A, 2bp5:M, 1bw8:A, 1bxx:A, 3h85:A, 1hes:A, 1i31:A, 7oiq:BBB, 2pr9:A, 5wrk:A
12	7rwa:M	379	60	0.1092	0.0501	0.3167	4.2	7rwa:m
13	7cta:A	329	41	0.0690	0.0365	0.2927	7.1	7ct9:A, 7ct9:B, 7cta:B
14	7vgh:B	1183	70	0.1207	0.0178	0.3000	9.8	7vgi:B

[Back]