MRLTALVSGHVQGVGYRLFVQRYARDLGLHGYAENLSDGKVEVIAEGDEDALNRLLHWLRRGPPHARVQAVDTQYSEETG
LREFHIY
The query sequence (length=87) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8jfs:A | 87 | 87 | 1.0000 | 1.0000 | 1.0000 | 2.42e-60 | 8jfs:B |
2 | 4hi1:A | 88 | 72 | 0.4023 | 0.3977 | 0.4861 | 7.37e-16 | 4hi1:B, 4hi1:C |
3 | 4g9i:A | 766 | 81 | 0.3448 | 0.0392 | 0.3704 | 2.90e-11 | 4g9i:B, 4g9i:C, 4g9i:D, 4g9i:E, 4g9i:F |
4 | 1gxu:A | 88 | 66 | 0.3103 | 0.3068 | 0.4091 | 4.74e-07 | |
5 | 3vth:A | 753 | 78 | 0.2759 | 0.0319 | 0.3077 | 5.62e-04 | 3vth:B, 3vti:A, 3vti:B |
6 | 3njv:A | 508 | 70 | 0.2184 | 0.0374 | 0.2714 | 0.13 | 3njx:A, 1nkg:A, 2xhn:A, 2xhn:B |
7 | 8der:L | 105 | 49 | 0.1379 | 0.1143 | 0.2449 | 0.42 | |
8 | 5l7j:A | 406 | 40 | 0.1839 | 0.0394 | 0.4000 | 0.64 | 6ia6:A, 5l7l:A |
9 | 2a68:C | 1119 | 49 | 0.2414 | 0.0188 | 0.4286 | 1.4 | 2a68:M, 2a69:C, 2a69:M, 2a6h:C, 2a6h:M, 3aoh:C, 2be5:C, 2be5:M, 6cuu:C, 5d4c:C, 5d4c:M, 5d4d:C, 5d4d:M, 5d4e:C, 5d4e:M, 3dxj:C, 3dxj:M, 5e17:C, 5e18:C, 7eh0:C, 7eh1:C, 7eh2:C, 7eh2:M, 3eql:C, 3eql:M, 4g7h:C, 4g7h:M, 4g7o:C, 4g7o:M, 4g7z:C, 4g7z:M, 8hsr:I, 5i2d:C, 5i2d:N, 1i6v:C, 1iw7:C, 1iw7:M, 6kqd:C, 6kqd:M, 6kqe:C, 6kqf:C, 6kqg:C, 6kqh:C, 6kql:C, 6kqm:C, 6kqn:C, 6l74:C, 6lts:C, 6m6a:C, 6m6c:C, 7mlb:C, 7mli:C, 7mlj:C, 4mq9:C, 2o5i:C, 2o5i:M, 2o5j:C, 2o5j:M, 4oin:C, 4oio:C, 4oip:C, 4oiq:C, 4oir:C, 6ovr:C, 6ovy:C, 6ow3:C, 6oy5:C, 6oy6:C, 6oy7:C, 6p70:C, 6p71:C, 2ppb:C, 2ppb:M, 4q4z:C, 4q5s:C, 7rdq:C, 1smy:C, 1smy:M, 5tmc:C, 5tmf:C, 5vo8:C, 5voi:C, 8w8n:C, 8w8o:C, 8w8p:C, 6wox:C, 6woy:C, 4wqs:C, 4wqs:M, 5x21:C, 5x22:C, 5x22:M, 4xln:C, 4xln:I, 4xlr:C, 4xlr:I, 1ynj:C, 1ynn:C, 1zyr:C, 1zyr:M |
10 | 8hsg:I | 1096 | 49 | 0.2414 | 0.0192 | 0.4286 | 1.4 | 3aoi:C, 3aoi:H, 3aoi:M, 4gzy:C, 4gzz:C |
11 | 7kmq:B | 754 | 41 | 0.1954 | 0.0225 | 0.4146 | 2.7 | 7kmq:A |
12 | 7yeo:B | 382 | 45 | 0.2069 | 0.0471 | 0.4000 | 4.8 | 7yeo:A |
13 | 4fe7:A | 380 | 31 | 0.1379 | 0.0316 | 0.3871 | 7.2 | |
14 | 3lst:A | 333 | 31 | 0.1379 | 0.0360 | 0.3871 | 8.2 | 3lst:B |
15 | 6vvo:A | 448 | 15 | 0.0920 | 0.0179 | 0.5333 | 9.6 |