BioLiP

>protein
MRLIPLTTAEQVGKWAARHIVNRINAFKPTADRPFVLGLPTGGTPMTTYKALVEMHKAGQVSFKHVVTFNMDEYVGLPKE
HPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQYEEKIRSYGKIHLFMGGVGNDGHIAFNEPASSLASRTRIK
TLTHDTRVANSRFFDNDVNQVPKYALTVGVGTLLDAEEVMILVLGSQKALALQAAVEGCVNHMWTISCLQLHPKAIMVCD
EPSTMELKVKTLRYFNELEAENIKGL

The query sequence (length=266) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1dea:A	266	266	1.0000	1.0000	1.0000	0.0	1dea:B, 1fqo:A, 1fqo:B, 1hor:A, 1hor:B, 1hot:A, 2wu1:A, 2wu1:B
2	5hj5:B	267	266	0.7932	0.7903	0.7932	7.64e-166	5hj5:A, 5hj5:C, 5hj5:D
3	1ne7:A	281	258	0.5789	0.5480	0.5969	3.37e-116	1ne7:B, 1ne7:C, 1ne7:E, 1ne7:F, 1ne7:D
4	3hn6:A	271	262	0.5977	0.5867	0.6069	4.76e-116	3hn6:B, 3hn6:F, 3hn6:D, 3hn6:E
5	2bkv:B	242	240	0.3571	0.3926	0.3958	3.30e-61	2bkv:A, 2bkx:A, 2bkx:B
6	2ri1:A	235	205	0.2970	0.3362	0.3854	1.35e-42	2ri1:B
7	3e7f:B	263	223	0.1992	0.2015	0.2377	1.49e-05	3e7f:A, 3eb9:A, 3eb9:B, 2j0e:A, 2j0e:B
8	3e15:D	295	115	0.1278	0.1153	0.2957	0.023
9	2is4:B	632	105	0.0977	0.0411	0.2476	0.34
10	3wbw:A	271	31	0.0489	0.0480	0.4194	5.3	3wbw:B, 3wby:A, 3wby:B
11	8ui7:A	643	36	0.0526	0.0218	0.3889	8.8	8ui8:A, 8ui9:A, 8uii:A
12	6yxx:BT	173	58	0.0827	0.1272	0.3793	9.8	7aoi:BT, 6hiv:BT, 6hix:BT, 6yxy:BT

[Back]