BioLiP

>protein
MRLAYVKNHEIYGEKLLGLTLRERIEKTLQRAGFDVRFFDELSLEEAEDYLIILEPVLILERDLLLEGRKILVSDGFTVG
YFFGGDFRTVFDGNLQSSIEKYLSLNNLESYEIWAIKLSNDNLKTAEKLLLSSLIGRGLFAAIFLPIARLLADWGVSPDA
VTVVGTLGVMAGALIFYPMGQLFWGTVVITVFVFSDIIDGLMARLLFREGPWGAFLDSYLDRVGDSSVFTGIVIWFFLGG
ANPTIAILALICLVLSSLVSYSKARAEGLGLTANVGIAERSERLVVVLVATGLVGLGIPSWVLLVVLIVLAIASVVTIFQ
RVLTVREQAKAWTA

The query sequence (length=334) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5d92:D	342	342	1.0000	0.9766	0.9766	0.0	5d91:A, 5d92:A, 5d92:B, 5d92:C
2	6wm5:A	337	327	0.6677	0.6617	0.6820	1.79e-149	6wm5:C, 6wmv:A, 6wmv:C
3	4o6m:B	341	349	0.5719	0.5601	0.5473	3.27e-106	4o6m:A, 4o6n:A, 4o6n:B, 4q7c:A, 4q7c:B
4	6h5a:B	209	191	0.2455	0.3923	0.4293	8.71e-38	6h59:A, 6h59:B, 6h5a:A
5	4mnd:A	408	214	0.1617	0.1324	0.2523	7.39e-05
6	6m53:B	339	100	0.0838	0.0826	0.2800	0.99	7bp1:A, 7bp1:C, 7bp1:D, 7bpc:A, 7bpc:C, 6m53:A, 6m53:C, 6m53:D
7	8gyw:B	380	211	0.1467	0.1289	0.2322	3.0	8gyw:A, 8gyx:B, 8gyx:A
8	6pdq:D	142	29	0.0329	0.0775	0.3793	6.5	6pdq:A
9	1e3a:B	560	69	0.0569	0.0339	0.2754	6.8	1ai4:B, 1ai5:B, 1ai6:B, 1ai7:B, 1ajn:B, 1ajp:B, 1ajq:B, 1fxh:B, 1fxv:B, 1gk9:B, 1gkf:B, 1gm7:B, 1gm8:B, 1gm9:B, 1h2g:B, 1jx9:B, 1k5q:B, 1k5s:B, 1k7d:B, 1kec:B, 1pnk:B, 1pnl:B, 1pnm:B
10	8ero:A	364	124	0.1048	0.0962	0.2823	7.9	8ero:B, 8erp:B, 8erp:A
11	5fl7:H	113	58	0.0449	0.1327	0.2586	8.4
12	8wcn:A	379	38	0.0389	0.0343	0.3421	8.7	8wcn:B
13	7pkt:b	304	29	0.0389	0.0428	0.4483	8.7

[Back]