MRKPSAGDFVKSIKSFIVSFSNNAPDPEKDCAMVQEFFSKMEAAFRAHPLWSGCSEEELDSAGDGLEKYVMTKLFTRVFA
SNTEEVIADEKLFQKMSLVQQFISPENLDIQPTFQNESSWLLAQKELQKINMYKAPRDKLVCILNCCKVINNLLLNASIA
SNENAPGADEFLPVLIYVTIKANPPQLHSNLLYIQRYRRESKLVGEAAYFFTNILSAESFISNIDAKSISLDEAEFEKNM
ESARAR
The query sequence (length=246) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2efe:A | 246 | 246 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 2efe:C, 4g01:A |
2 | 1txu:A | 254 | 189 | 0.2764 | 0.2677 | 0.3598 | 1.43e-31 | |
3 | 3l22:A | 429 | 36 | 0.0610 | 0.0350 | 0.4167 | 1.8 | |
4 | 5ze9:F | 456 | 48 | 0.0650 | 0.0351 | 0.3333 | 5.6 | 7coq:F, 7dqd:E, 7dqd:F, 7dqd:M, 7dqd:N, 8igv:D, 8igv:E, 8igw:D, 8igw:J, 8igw:L, 5knc:F, 3vr3:E, 3vr3:F, 3vr6:E, 3vr6:F, 7vw7:E, 7vw7:F, 5ze9:D, 5ze9:E |
5 | 6x5b:B | 149 | 56 | 0.0732 | 0.1208 | 0.3214 | 6.2 | 6x5b:E, 6x5b:K, 6x5c:B, 6x5c:G, 6x5c:F |
6 | 7mjr:A | 899 | 57 | 0.0650 | 0.0178 | 0.2807 | 6.2 | |
7 | 3qrf:G | 82 | 73 | 0.0772 | 0.2317 | 0.2603 | 7.0 | 3qrf:F, 3qrf:H, 3qrf:I, 4wk8:F, 4wk8:G |
8 | 2dja:A | 84 | 26 | 0.0447 | 0.1310 | 0.4231 | 8.6 | |
9 | 4o1k:A | 211 | 40 | 0.0528 | 0.0616 | 0.3250 | 10.0 |