BioLiP

>protein
MRIVAADTGGAVLDESFQPVGLIATVAVLVEKPYKTSKRFLVKYADPYNYDLSGRQAIRDEIELAIELAREVSPDVIHLD
STLGGIEVRKLDESTIDALQISDRGKEIWKELSKDLQPLAKKFWEETGIEIIAIGKSSVPVRIAEIYAGIFSVKWALDNV
KEKGGLLVGLPRYMEVEIKKDKIIGKSLDPREGGLYGEVKTEVPQGIKWELYPNPLVRRFMVFEITS

The query sequence (length=227) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4yor:A	227	227	1.0000	1.0000	1.0000	1.15e-163	4yor:B, 4yot:A, 4yot:B, 4yot:C, 4you:A, 4you:C, 4yov:A, 4yov:C, 4yov:E, 4yow:A, 4yow:C, 4yow:E, 4yox:A, 4yox:C, 4yox:E, 4yoy:A, 4yoy:C, 4yoy:E
2	5chi:A	230	227	0.7753	0.7652	0.7753	8.57e-133	5chi:B, 5chi:C
3	4you:B	199	227	0.8722	0.9950	0.8722	8.92e-132
4	4nu0:A	212	76	0.0969	0.1038	0.2895	0.65	4nu0:B, 4w5j:A, 4w5j:B, 4w5j:C, 4w5j:D
5	4mz0:A	896	50	0.0705	0.0179	0.3200	1.0
6	6muk:A	363	30	0.0529	0.0331	0.4000	1.3
7	7tom:A	498	32	0.0573	0.0261	0.4062	1.5	7tol:A
8	8bz6:A	606	64	0.0837	0.0314	0.2969	3.9	8bz6:B, 8bz6:C, 8bz6:D, 8bz6:E, 8bz6:F, 8bz7:A, 8bz7:B, 8bz7:C, 8bz7:D, 8bz7:E, 8bz7:F, 8bz8:A, 8bz8:B, 8bz8:C, 8bz8:D, 8bz8:E, 8bz8:F
9	8cjf:B	638	39	0.0573	0.0204	0.3333	4.4	8cjd:A, 8cjd:B, 8cje:A, 8cje:B, 8cje:C, 8cje:D, 8cjf:A, 8cjg:A, 8cjg:B, 8jz2:A, 8jz3:A, 8jz4:A, 8jz5:A, 8jz6:A
10	4why:L	218	53	0.0749	0.0780	0.3208	4.4	5aum:L, 5aum:B, 4wht:B, 4wht:D, 4wht:F, 4wht:H, 4wht:J, 4wht:L, 4wht:N, 4wht:R, 4wht:P, 4wht:T, 4wht:V, 4wht:Y, 4why:J, 4why:N, 4why:H

[Back]