MRACLKCKYLTNDEICPICHSPTSENWIGLLIVINPEKSEIAKKAGIDIKGKYALSVKE
The query sequence (length=59) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4zn3:B | 67 | 58 | 0.9831 | 0.8657 | 1.0000 | 8.87e-38 | 3lpe:B, 3lpe:D, 3lpe:F, 3lpe:H, 4zn1:B |
2 | 1ryq:A | 64 | 58 | 0.4576 | 0.4219 | 0.4655 | 3.77e-14 | 8oki:I, 8p2i:I, 3p8b:A, 3p8b:C, 3qqc:E |
3 | 9bct:I | 65 | 64 | 0.4407 | 0.4000 | 0.4062 | 7.84e-09 | |
4 | 5zvq:A | 194 | 20 | 0.1695 | 0.0515 | 0.5000 | 0.057 | 8ab0:F, 8ab0:E, 8bpr:E, 8bpr:F |
5 | 5z2v:B | 197 | 50 | 0.2373 | 0.0711 | 0.2800 | 0.078 | 5z2v:A |
6 | 1n7u:A | 554 | 40 | 0.2373 | 0.0253 | 0.3500 | 0.81 | |
7 | 2exu:A | 192 | 74 | 0.3898 | 0.1198 | 0.3108 | 1.1 | |
8 | 5ai2:A | 54 | 20 | 0.1695 | 0.1852 | 0.5000 | 1.7 | 5ai3:A, 4ar3:A, 4ar4:A, 4ar5:A, 4ar6:A, 9bkl:A, 9bkp:A, 9bkt:A, 1bq8:A, 1bq9:A, 1brf:A, 1caa:A, 1cad:A, 1iu5:A, 1iu6:A, 4k9f:A, 3kyu:A, 3kyv:A, 3kyw:A, 3kyx:A, 3kyy:A, 5nw3:A, 5ome:A, 3ryg:A, 3rz6:A, 3rzt:A, 3ss2:A, 1vcx:A, 1zrp:A |
9 | 5bv9:A | 701 | 17 | 0.1356 | 0.0114 | 0.4706 | 2.2 | 5cvy:A, 5vma:A |
10 | 7kw6:A | 697 | 16 | 0.1186 | 0.0100 | 0.4375 | 3.1 | |
11 | 8do8:B | 192 | 25 | 0.2034 | 0.0625 | 0.4800 | 3.3 | 5c50:B, 8do8:D |
12 | 2ff0:A | 102 | 20 | 0.1525 | 0.0882 | 0.4500 | 4.5 | 2a66:A, 5l0m:A, 8pki:K |
13 | 2aqc:A | 63 | 23 | 0.1864 | 0.1746 | 0.4783 | 4.6 | 2apo:B |
14 | 2pve:A | 52 | 18 | 0.1525 | 0.1731 | 0.5000 | 5.2 | 2pve:B, 2pve:C |
15 | 2aus:D | 53 | 23 | 0.1695 | 0.1887 | 0.4348 | 5.3 | 2aus:B, 2ey4:E, 2ey4:F, 3hax:C, 3hay:C, 3hjw:B, 2hvy:C, 3lwo:B, 3lwp:B, 3lwq:B, 3lwr:B, 3lwv:B, 2rfk:B |
16 | 8ab0:D | 157 | 17 | 0.1356 | 0.0510 | 0.4706 | 5.5 | 8bpr:D |
17 | 6hip:A | 104 | 38 | 0.2034 | 0.1154 | 0.3158 | 5.7 | 6hip:B, 5lso:A, 5lso:B, 2peh:A, 2peh:B |
18 | 6z2w:E | 2325 | 34 | 0.2373 | 0.0060 | 0.4118 | 5.9 | 6z2w:F, 6z2x:E, 6z2x:F, 6z3a:F, 6z3a:E |
19 | 6knb:B | 1120 | 24 | 0.1186 | 0.0063 | 0.2917 | 7.9 | 6knc:B |
20 | 5ztb:B | 311 | 19 | 0.1186 | 0.0225 | 0.3684 | 8.2 | 5b4e:A, 5b4f:A, 5gha:A, 5gha:D, 5gha:B, 5gha:C, 5ztb:A, 5ztb:C |
21 | 5y9e:E | 420 | 27 | 0.1864 | 0.0262 | 0.4074 | 9.4 | 5y9e:A, 5y9e:B, 5y9e:C, 5y9e:D |
22 | 8xmc:B | 1082 | 21 | 0.1525 | 0.0083 | 0.4286 | 9.9 | 7eu1:B, 8xmb:B |
23 | 8xmd:B | 1061 | 21 | 0.1525 | 0.0085 | 0.4286 | 10.0 | 7eu0:B, 8hyj:B, 8xme:B |