BioLiP

>protein
MQYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWCYDDATKTFTVTE

The query sequence (length=56) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2i2y:A	150	56	0.9821	0.3667	0.9821	8.97e-34	9asq:H, 5bmg:A, 5bmg:B, 5bmg:H, 5bmg:D, 5bmg:E, 5bmg:F, 5bmg:G, 5bmh:A, 3v3x:C, 3v3x:D
2	6nl8:A	56	56	0.8750	0.8750	0.8750	4.79e-29	6nla:A
3	5o94:A	56	56	0.8214	0.8214	0.8214	3.82e-28	5ofs:A, 5ofs:B, 5ofs:C, 5ofs:D
4	7rxc:B	439	54	0.8393	0.1071	0.8704	2.19e-26	7rxd:B
5	5lde:B	225	53	0.7679	0.1911	0.8113	1.07e-20	5lde:A
6	6nl6:B	56	56	0.7500	0.7500	0.7500	5.20e-19	6nl6:C, 6nl6:D, 6nl7:B
7	8jxr:C	341	54	0.5893	0.0968	0.6111	2.13e-11
8	8khn:A	287	33	0.2143	0.0418	0.3636	0.59	8kho:A
9	7nrr:AAA	329	32	0.2500	0.0426	0.4375	0.86	7nrr:BBB, 7nsw:AAA, 7nsw:BBB, 7ntd:AAA, 7ntd:BBB, 7nte:A, 7nte:B
10	6dft:F	321	23	0.1607	0.0280	0.3913	2.4	6dft:B, 6dft:D, 6dft:H, 6dft:J, 6dft:L
11	8sxg:A	366	17	0.1607	0.0246	0.5294	6.6	8sxe:A, 8sxe:B, 8sxf:A, 8sxh:A, 8sxh:E, 8sxh:I
12	1wnb:A	474	21	0.1607	0.0190	0.4286	6.7	1wnb:B, 1wnb:C, 1wnb:D, 1wnd:A, 1wnd:B, 1wnd:C, 1wnd:D
13	7esn:A	435	32	0.2143	0.0276	0.3750	8.7	7esk:A, 7esm:A, 8i4d:A, 7yqs:A
14	5mcp:F	342	35	0.2143	0.0351	0.3429	9.2

[Back]