BioLiP

>protein
MQSWYLLYCKRGQLQRAQEHLERQAVNCLAPMITLEKIVRGKRTAVSEPLFPNYLFVEFDPEVIHTTTINATRGVSHFVR
FGASPAIVPSAVIHQLSVYKP

The query sequence (length=101) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8phk:P	162	101	1.0000	0.6235	1.0000	4.44e-73	6c6s:D, 6c6t:D, 8pen:P, 8pfj:P, 8pid:P, 8pil:P, 8pim:P, 8upo:AB, 8upr:AB, 8uql:AB, 8uqm:AB, 8uqp:AB, 8ur0:AB, 8urh:AB, 8uri:AB, 8urx:AB, 8ury:AB
2	8pfg:P	136	101	0.9901	0.7353	0.9901	8.22e-72	5ond:A, 5ond:B, 8pib:P
3	8f5g:C	175	93	0.2376	0.1371	0.2581	1.02e-04	8f5g:A
4	8e74:Z	122	93	0.2079	0.1721	0.2258	0.009	8e82:Z
5	8f5g:B	144	56	0.1485	0.1042	0.2679	0.089
6	8syi:G	120	90	0.2079	0.1750	0.2333	0.82	8urw:G
7	2d09:A	404	66	0.1881	0.0470	0.2879	0.86	2d0e:A, 5de9:A, 5de9:B, 1s1f:A, 1se6:A, 1se6:B, 1t93:A, 3tzo:A, 3tzo:B
8	2dkk:A	399	32	0.1386	0.0351	0.4375	1.1	2nz5:A, 2nz5:B, 2nza:A, 2nza:B
9	3dnf:B	282	83	0.2376	0.0851	0.2892	1.6	3dnf:A
10	5d88:A	247	72	0.1881	0.0769	0.2639	1.7
11	5yij:A	959	38	0.1386	0.0146	0.3684	1.9	5ysi:A
12	8em4:A	3818	88	0.2376	0.0063	0.2727	2.0	8em4:B
13	8em7:A	4378	88	0.2376	0.0055	0.2727	2.0	8em7:B, 8jut:A, 8jut:B, 8juu:B, 8juu:A, 8jx8:B, 8jx8:A, 8jx9:B, 8jxa:A, 8jxb:A, 8jxd:A, 8jxe:A, 8jxe:B, 8jxf:B, 8jxg:A, 8jxh:A, 8jxi:B
14	7slp:A	239	38	0.0990	0.0418	0.2632	7.1	7slq:A
15	6dcb:A	225	38	0.0990	0.0444	0.2632	8.1	6dcc:A, 5una:C, 5una:A, 5una:B, 5una:D, 5una:E, 5una:F
16	3eqt:B	142	48	0.1485	0.1056	0.3125	8.4	3eqt:A, 2rqa:A
17	8ehq:G	110	92	0.2079	0.1909	0.2283	8.8	8ej3:G, 8eoe:G, 8eof:G, 8exy:G

[Back]