BioLiP

>protein
MQKGNFRNQRKTVKCFNCGKEGHIAKNCRAPRKKGCWKCGKEGHQMKDCTERQAN

The query sequence (length=55) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6rwg:A	157	55	0.9818	0.3439	0.9818	6.87e-36	1a1t:A, 1aaf:A, 1bj6:A, 2buo:A, 1esk:A, 2exf:A, 1f6u:A, 5i1r:A, 2jzw:A, 2l4l:A, 2m3z:A, 1mfs:A, 1q3y:A, 1q3z:A, 7r7p:I, 7r7p:L
2	2ec7:A	49	47	0.5818	0.6531	0.6809	1.92e-19
3	2a51:A	39	37	0.3636	0.5128	0.5405	1.36e-10
4	2bl6:A	37	35	0.3455	0.5135	0.5429	5.30e-07
5	2bl6:A	37	28	0.2000	0.2973	0.3929	3.9
6	7c4c:A	332	46	0.3455	0.0572	0.4130	1.18e-05	7c42:A, 7c43:A, 7c45:A, 7c47:A, 7c4b:A
7	7c4c:A	332	41	0.2364	0.0392	0.3171	0.11	7c42:A, 7c43:A, 7c45:A, 7c47:A, 7c4b:A
8	5w0n:A	379	23	0.2364	0.0343	0.5652	0.009	5w0m:A, 5w0m:C, 5w0n:B
9	5w0b:A	334	20	0.2182	0.0359	0.6000	0.020
10	7s7b:F	352	14	0.1818	0.0284	0.7143	0.044	7s7b:B, 7s7c:B
11	7s7b:F	352	17	0.1818	0.0284	0.5882	0.14	7s7b:B, 7s7c:B
12	2ihx:A	50	43	0.2909	0.3200	0.3721	0.13
13	2li8:A	63	38	0.2545	0.2222	0.3684	0.16
14	5udz:A	139	48	0.2909	0.1151	0.3333	0.16	8ops:B, 8opt:B, 8ost:B, 3trz:A, 3trz:B, 3trz:C, 3trz:D, 3trz:E, 3trz:F, 3ts0:A, 3ts0:B, 3ts2:A, 3ts2:B, 5udz:B
15	2cqf:A	63	38	0.2545	0.2222	0.3684	0.21
16	3nyb:B	64	21	0.1636	0.1406	0.4286	0.29
17	2ysa:A	55	14	0.1818	0.1818	0.7143	0.41
18	2ysa:A	55	14	0.1455	0.1455	0.5714	0.94
19	8opp:A	670	22	0.1636	0.0134	0.4091	0.71
20	8opp:A	670	16	0.1636	0.0134	0.5625	1.8
21	8opt:A	783	22	0.1636	0.0115	0.4091	0.71	8ops:A, 5w0m:B, 5w0n:C, 5w0o:A, 5w0o:B
22	8opt:A	783	16	0.1636	0.0115	0.5625	1.8	8ops:A, 5w0m:B, 5w0n:C, 5w0o:A, 5w0o:B
23	7od9:B	129	24	0.1455	0.0620	0.3333	1.1	6ekg:Y, 6ekh:Y, 7od9:A
24	6bk8:O	229	28	0.2182	0.0524	0.4286	1.1
25	6bk8:O	229	17	0.1636	0.0393	0.5294	1.6
26	2lli:A	124	18	0.1455	0.0645	0.4444	1.4
27	6exn:c	204	17	0.1636	0.0441	0.5294	1.7
28	6exn:c	204	28	0.2182	0.0588	0.4286	4.3
29	5yud:A	1238	14	0.1455	0.0065	0.5714	1.9
30	3zt9:A	192	26	0.1636	0.0469	0.3462	2.1
31	3ir9:A	162	53	0.2909	0.0988	0.3019	2.3	3ir9:B
32	7rav:A	773	14	0.1455	0.0103	0.5714	2.3
33	6lum:A	539	25	0.1273	0.0130	0.2800	4.7	6lum:J, 6lum:P
34	7b9v:c	37	17	0.1636	0.2432	0.5294	4.9
35	4f3x:A	476	26	0.1636	0.0189	0.3462	7.1	4f3x:B, 4f3x:C, 4f3x:D
36	4xgl:A	342	18	0.1636	0.0263	0.5000	8.5	4rou:B, 4rou:A, 4xgm:A
37	8oki:B	1101	28	0.2182	0.0109	0.4286	9.2	8cro:B, 8orq:B, 8p2i:B, 8rbo:B
38	8cbk:E	470	18	0.1636	0.0191	0.5000	9.5	7onu:E

[Back]