MQFKLILNGKTLKGVITIEAVDHAEAEKFFKQYANDNGVDGEWTYDEATHTFTVTE
The query sequence (length=56) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5o94:A | 56 | 56 | 1.0000 | 1.0000 | 1.0000 | 1.40e-36 | 5ofs:A, 5ofs:B, 5ofs:C, 5ofs:D |
2 | 2i2y:A | 150 | 56 | 0.8393 | 0.3133 | 0.8393 | 3.96e-28 | 9asq:H, 5bmg:A, 5bmg:B, 5bmg:H, 5bmg:D, 5bmg:E, 5bmg:F, 5bmg:G, 5bmh:A, 3v3x:C, 3v3x:D |
3 | 6nl8:A | 56 | 56 | 0.7679 | 0.7679 | 0.7679 | 2.01e-24 | 6nla:A |
4 | 7rxc:B | 439 | 54 | 0.7143 | 0.0911 | 0.7407 | 5.98e-21 | 7rxd:B |
5 | 6nl6:B | 56 | 56 | 0.6786 | 0.6786 | 0.6786 | 1.54e-15 | 6nl6:C, 6nl6:D, 6nl7:B |
6 | 5lde:B | 225 | 53 | 0.6429 | 0.1600 | 0.6792 | 2.23e-15 | 5lde:A |
7 | 8jxr:C | 341 | 55 | 0.5179 | 0.0850 | 0.5273 | 7.01e-08 | |
8 | 6dft:F | 321 | 26 | 0.1786 | 0.0312 | 0.3846 | 1.7 | 6dft:B, 6dft:D, 6dft:H, 6dft:J, 6dft:L |
9 | 5lz6:A | 126 | 35 | 0.2321 | 0.1032 | 0.3714 | 2.7 | 6q67:A, 6q68:A |
10 | 2ddu:A | 301 | 39 | 0.2500 | 0.0465 | 0.3590 | 4.5 | |
11 | 6y87:A | 470 | 31 | 0.1964 | 0.0234 | 0.3548 | 8.2 | 6y87:B, 6y87:C, 6y87:D, 6y87:E, 6y87:F |
12 | 8hl1:AEFG | 725 | 52 | 0.3214 | 0.0248 | 0.3462 | 8.6 | 8hl2:AEFG, 8hl3:AEFG, 8hl4:AEFG |