BioLiP

>protein
MPVGSLQELAVQKGWRLPEYTVAQFTITCRVETFVETGSGTSKQVAKRVAAEKLLTKFKT

The query sequence (length=60) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1di2:B	60	60	1.0000	1.0000	1.0000	9.85e-39
2	1di2:A	69	69	1.0000	0.8696	0.8696	1.53e-35
3	7zpk:C	233	68	0.7000	0.1803	0.6176	3.18e-22	3adl:A, 5n8l:A, 5n8m:A
4	8dfv:K	253	67	0.3833	0.0909	0.3433	6.94e-09	8dg5:K
5	6sdw:A	177	63	0.3500	0.1186	0.3333	9.24e-05	6htu:A, 6htu:B, 6htu:C, 6sdy:A
6	1ekz:A	76	67	0.2833	0.2237	0.2537	0.003
7	7scf:A	321	41	0.2667	0.0498	0.3902	0.13	7scf:B, 7sew:A, 7sex:A, 7sey:A, 7sf4:A, 7sf4:B, 7sf5:A, 7sf5:B
8	1yyk:A	221	60	0.3167	0.0860	0.3167	0.58	2ez6:A, 2ez6:B, 1jfz:A, 1jfz:B, 1jfz:C, 1jfz:D, 4m2z:A, 4m2z:B, 4m30:A, 4m30:B, 2nue:A, 2nuf:A, 2nuf:B, 2nug:A, 2nug:B, 1rc5:A, 1rc5:B, 1rc5:C, 1rc5:D, 1rc7:A, 1yyo:A, 1yyw:A, 1yyw:C, 1yz9:A
9	2l3j:A	236	34	0.2500	0.0636	0.4412	1.4	2l3c:A
10	7r97:A	226	69	0.4000	0.1062	0.3478	2.0	7r97:B
11	4hpp:A	426	28	0.1667	0.0235	0.3571	3.8
12	6gzt:A	267	37	0.1833	0.0412	0.2973	7.1	6fdk:A, 6fdq:A, 6fdq:B, 6fdu:B, 6gzs:A
13	7mq9:LM	2005	52	0.2500	0.0075	0.2885	8.1
14	7mqa:LM	2041	52	0.2500	0.0073	0.2885	8.1
15	4hdq:A	311	21	0.1500	0.0289	0.4286	9.1	6oq3:A, 6oq4:A, 8su8:A, 8t09:A, 8t7v:A, 3u7d:A, 3u7d:C, 6uzk:A

[Back]