BioLiP

>protein
MPEDILVDIKRDYVLSKLRDNERIDGRGFDEFRKVEIIPNVIEKAEGSALVKLGDTQVVVGVKMQPGEPAPDTPDRGVII
VNAELVPLASPTFEPGPPDENSIELARVVDRGIRESEAVDLSKLVIEEGEKVWIVFVDIHALDDDGNLLDASALAAIAAL
MNTKVPAERFDLGEDYLLPVRDLPVSVTSLIVGNKYLVDPSREEMSVGDTTLTITTDKDDNVVAMQKSGGYLLDEKLFDE
LLDVSINCARKLREKFKE

The query sequence (length=258) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3m85:I	259	258	1.0000	0.9961	1.0000	0.0	3m7n:I, 3m7n:G, 3m7n:H, 3m85:G, 3m85:H
2	2pnz:B	267	256	0.5194	0.5019	0.5234	1.58e-76
3	4ba2:A	274	262	0.4380	0.4124	0.4313	4.20e-62	2c37:I, 2c37:U, 2c38:G, 2c38:I, 2c38:U, 2c38:W, 2jea:A
4	6d6q:C	265	229	0.3140	0.3057	0.3537	2.97e-42	6d6r:C
5	4ifd:A	300	247	0.3023	0.2600	0.3158	6.13e-36	6fsz:AA
6	6d6q:A	287	257	0.3140	0.2822	0.3152	2.35e-31	6d6r:A
7	2wnr:B	222	240	0.2442	0.2838	0.2625	1.62e-14	2wnr:D, 2wnr:F
8	2pnz:A	236	243	0.2248	0.2458	0.2387	3.98e-11	2po0:A, 2po1:A, 2po2:A
9	3m7n:E	248	226	0.2287	0.2379	0.2611	5.47e-11	3m7n:F, 3m7n:D, 3m85:F, 3m85:D, 3m85:E
10	2c39:D	248	153	0.1860	0.1935	0.3137	6.61e-10	4ba1:B, 4ba2:B, 2c37:B, 2c37:F, 2c37:N, 2c37:V, 2c37:X, 2c38:B, 2c38:F, 2c38:H, 2c38:J, 2c38:N, 2c38:V, 2c38:X, 2c39:B, 2c39:F, 2c39:H, 2c39:J, 2c39:L, 2c39:N, 2c39:P, 2c39:R, 2c39:T, 2c39:V, 2c39:X, 2jea:B
11	1r6m:A	236	145	0.1628	0.1780	0.2897	4.60e-09
12	3dd6:A	244	236	0.2481	0.2623	0.2712	4.92e-09
13	6d6q:B	241	231	0.2093	0.2241	0.2338	8.69e-07	6d6r:B
14	4oo1:E	255	200	0.1705	0.1725	0.2200	7.36e-04
15	8wx0:A	597	157	0.1589	0.0687	0.2611	0.002	8wx0:B, 8wx0:C
16	3gme:A	482	255	0.2403	0.1286	0.2431	0.002
17	7ld5:A	587	42	0.0736	0.0324	0.4524	0.002	7ld5:B, 7ld5:C
18	7ogk:A	695	261	0.2403	0.0892	0.2375	0.006	3gcm:A, 3gcm:B, 3gcm:C, 3h1c:A, 3h1c:B, 3h1c:C, 3h1c:K, 3h1c:G, 3h1c:I, 3h1c:M, 3h1c:O, 3h1c:R, 3h1c:T, 3h1c:V, 3h1c:X, 7ogk:B, 7ogk:C, 7ogm:L, 7ogm:N, 7ogm:O
19	1e3p:A	645	42	0.0581	0.0233	0.3571	0.17
20	6fsz:BB	244	143	0.1434	0.1516	0.2587	0.31	4ifd:B, 5jea:B, 5k36:B, 8qcf:C
21	3l1e:A	105	68	0.0698	0.1714	0.2647	0.65
22	5yjj:A	442	56	0.0775	0.0452	0.3571	1.6	5yjj:B, 5yjj:C, 5yjj:D, 5yjj:E, 5yjj:F
23	6f2r:Q	89	65	0.0814	0.2360	0.3231	3.3	6f2r:T, 6f2r:V
24	5lum:A	78	56	0.0814	0.2692	0.3750	3.8	5lum:B, 5lum:D, 5lum:C, 5lum:E
25	5ewu:A	383	47	0.0465	0.0313	0.2553	5.4	5ewu:B

[Back]