MNVIMREIGKKLDELSREFYESVIPPIDMYEEGGELVVVADLAGFNKDKISVRLSAQNELIINAEREIQYIGTKYATQRP
LKIHKVIRLPVKVKRDSQVTAKYENGVLTIRIPVEGSVSIRIE
The query sequence (length=123) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 4yl9:D | 123 | 123 | 1.0000 | 1.0000 | 1.0000 | 9.71e-86 | |
| 2 | 3vqm:A | 111 | 109 | 0.5935 | 0.6577 | 0.6697 | 3.58e-48 | 3vqm:B, 3vqm:C, 3vqm:E, 3vqm:F, 3vqm:I, 3vqm:K, 3vqm:M, 3vqm:N |
| 3 | 3gla:B | 99 | 97 | 0.2602 | 0.3232 | 0.3299 | 3.24e-05 | 3gla:A |
| 4 | 5zs3:A | 113 | 90 | 0.2033 | 0.2212 | 0.2778 | 4.80e-04 | 5zs6:A |
| 5 | 5oql:c | 175 | 43 | 0.1382 | 0.0971 | 0.3953 | 0.80 | |
| 6 | 2gq3:A | 720 | 36 | 0.0976 | 0.0167 | 0.3333 | 0.93 | 6apz:A, 6as6:A, 6asu:A, 6au9:A, 6axb:A, 6ba7:A, 6bu1:A, 6c2x:A, 6c6o:A, 5c7v:A, 6c7b:A, 6c8p:A, 5c9r:A, 5c9u:A, 5c9w:A, 5c9x:A, 5cah:A, 5cak:A, 5cbb:A, 5cbi:A, 5cbj:A, 5cc3:A, 5cc5:A, 5cc6:A, 5cc7:A, 5ccz:A, 5cew:A, 5cjm:A, 5cjn:A, 6dko:A, 6dl9:A, 6dlj:A, 6dnp:A, 5drc:A, 5dri:A, 5dx7:A, 5e9x:A, 5ecv:A, 2gq3:B, 5h8m:A, 5h8u:A, 5h8u:B, 1n8i:A, 1n8w:A, 1n8w:B, 3s9i:A, 3s9z:A, 3sad:A, 3saz:A, 3sb0:A, 5t8g:A |
| 7 | 4nv1:E | 242 | 31 | 0.1138 | 0.0579 | 0.4516 | 1.4 | 4nv1:C, 4nv1:D, 4nv1:F, 4nv1:B, 4nv1:A, 4nv1:G, 4nv1:H |
| 8 | 6vtj:A | 472 | 42 | 0.0976 | 0.0254 | 0.2857 | 3.9 | |
| 9 | 7uft:A | 1032 | 34 | 0.0894 | 0.0107 | 0.3235 | 4.2 | 7uft:B, 7uft:C, 7uft:D |
| 10 | 7smk:A | 455 | 26 | 0.0894 | 0.0242 | 0.4231 | 5.2 | 7snv:A |
| 11 | 7oa6:B | 152 | 33 | 0.1138 | 0.0921 | 0.4242 | 5.3 | 7oa6:I |
| 12 | 1htt:A | 366 | 32 | 0.0894 | 0.0301 | 0.3438 | 7.1 | 1htt:B, 1htt:C, 1htt:D, 1kmm:B, 1kmm:D, 1kmn:B, 1kmn:D |
| 13 | 5x8f:B | 485 | 23 | 0.0732 | 0.0186 | 0.3913 | 8.1 | 5buq:B, 5bur:A, 5bur:B, 5bus:A, 5bus:B, 5gtd:A, 5gtd:B, 5x8f:A, 5x8f:C, 5x8f:D, 5x8g:A, 5x8g:B, 5x8g:D, 5x8g:C |
| 14 | 7r76:A | 1834 | 59 | 0.1545 | 0.0104 | 0.3220 | 8.9 | 7r77:A |
| 15 | 1kmm:C | 387 | 31 | 0.0894 | 0.0284 | 0.3548 | 9.0 | 2el9:A, 2el9:B, 2el9:C, 2el9:D, 1kmm:A, 1kmn:A, 1kmn:C |
| 16 | 7r78:A | 1880 | 59 | 0.1545 | 0.0101 | 0.3220 | 9.0 |
umich.edu