MNTRTIYLAGGSFWGLEAYFQRIDGVVDAVSGYANGNTKNPSYEDVSYRHTGHAETVKVTYDADKLSLDDILQYFFRVVD
PTSLNKQGNDTGTQYRSGVYYTDPAEKAVIAAALKREQQKYQLPLVVENEPLKNFYDAEEYHQDYLIKNPNGYCHIDIRK
ADEPLPG
The query sequence (length=167) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3bqf:A | 167 | 167 | 1.0000 | 1.0000 | 1.0000 | 6.11e-125 | |
2 | 7e43:B | 324 | 164 | 0.5868 | 0.3025 | 0.5976 | 3.99e-67 | 7e43:A |
3 | 3e0m:C | 313 | 160 | 0.4970 | 0.2652 | 0.5188 | 7.39e-56 | 3e0m:A, 3e0m:B |
4 | 4d7l:A | 213 | 168 | 0.3952 | 0.3099 | 0.3929 | 2.93e-31 | 4d7l:B, 4d7l:C |
5 | 4lwm:A | 205 | 143 | 0.3054 | 0.2488 | 0.3566 | 3.95e-20 | |
6 | 7nit:D | 1253 | 87 | 0.1557 | 0.0208 | 0.2989 | 0.50 | 5dmy:A, 5dmy:B, 5dmy:C, 7nit:A, 7nit:B, 7nit:C, 7nit:E, 7nit:F, 6qub:A, 6qub:B, 6quc:A, 6quc:B |
7 | 6l2n:A | 217 | 58 | 0.1138 | 0.0876 | 0.3276 | 3.0 | 5iff:A, 5iff:B, 6l2n:B, 6l2o:A, 6l2o:B, 6m3l:A, 3waz:A, 3waz:B |
8 | 6xkw:p | 254 | 57 | 0.1018 | 0.0669 | 0.2982 | 3.3 | 6xkx:p, 6xkz:p |
9 | 1dgp:A | 290 | 58 | 0.1198 | 0.0690 | 0.3448 | 6.0 | 1dgp:B |
10 | 6c7n:A | 553 | 55 | 0.0958 | 0.0289 | 0.2909 | 9.2 | 6c7n:B, 6c7n:C |