MNPNCARCGKIVYPTEKVNCLDKFWHKACF
The query sequence (length=30) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1zfo:A | 30 | 30 | 1.0000 | 1.0000 | 1.0000 | 6.70e-18 | |
2 | 1b8t:A | 192 | 29 | 0.5000 | 0.0781 | 0.5172 | 1.12e-04 | 1ctl:A |
3 | 1b8t:A | 192 | 26 | 0.4000 | 0.0625 | 0.4615 | 0.082 | 1ctl:A |
4 | 2o13:A | 58 | 26 | 0.5333 | 0.2759 | 0.6154 | 1.77e-04 | |
5 | 2cu8:A | 76 | 30 | 0.5000 | 0.1974 | 0.5000 | 0.001 | |
6 | 1iml:A | 76 | 28 | 0.4333 | 0.1711 | 0.4643 | 0.003 | |
7 | 1cxx:A | 59 | 26 | 0.4667 | 0.2373 | 0.5385 | 0.005 | 1ibi:A, 1qli:A |
8 | 1a7i:A | 60 | 26 | 0.3667 | 0.1833 | 0.4231 | 0.006 | |
9 | 2o10:A | 60 | 29 | 0.3667 | 0.1833 | 0.3793 | 0.015 | |
10 | 8y6k:A | 741 | 26 | 0.3333 | 0.0135 | 0.3846 | 0.041 | 2bra:A, 2bra:B, 2bry:A, 2bry:B, 2c4c:A, 2c4c:B, 4txi:A, 4txk:A |
11 | 2lzu:A | 72 | 30 | 0.3667 | 0.1528 | 0.3667 | 0.10 | |
12 | 2co8:A | 82 | 26 | 0.3333 | 0.1220 | 0.3846 | 0.27 | |
13 | 2d8y:A | 91 | 26 | 0.3333 | 0.1099 | 0.3846 | 0.29 | |
14 | 2dj7:A | 80 | 27 | 0.3333 | 0.1250 | 0.3704 | 0.52 | |
15 | 2cuq:A | 80 | 28 | 0.3667 | 0.1375 | 0.3929 | 1.4 | |
16 | 6cme:A | 154 | 28 | 0.3000 | 0.0584 | 0.3214 | 1.6 | 6cme:B, 3mmk:A, 3mmk:B |
17 | 8yhd:G | 234 | 16 | 0.2667 | 0.0342 | 0.5000 | 2.2 | 8yhe:G, 8z4j:G, 8z4l:G, 8z99:G, 8z9c:G |
18 | 5wwp:B | 591 | 21 | 0.2667 | 0.0135 | 0.3810 | 2.2 | |
19 | 5wwp:A | 515 | 21 | 0.2667 | 0.0155 | 0.3810 | 3.1 | |
20 | 4v8p:AA | 91 | 16 | 0.2667 | 0.0879 | 0.5000 | 3.3 | 4v8p:DA, 4v8p:FA, 4v8p:HA |
21 | 1m3v:A | 122 | 26 | 0.2667 | 0.0656 | 0.3077 | 3.4 | |
22 | 2jtn:A | 182 | 28 | 0.3000 | 0.0495 | 0.3214 | 3.8 | |
23 | 7zpq:CC | 114 | 17 | 0.3000 | 0.0789 | 0.5294 | 4.1 | 7zrs:CC, 7zuw:CC |
24 | 1x4k:A | 72 | 28 | 0.3333 | 0.1389 | 0.3571 | 4.4 | |
25 | 2l4z:A | 121 | 26 | 0.2667 | 0.0661 | 0.3077 | 6.4 | |
26 | 2rgt:B | 154 | 28 | 0.3000 | 0.0584 | 0.3214 | 6.7 | 2rgt:A |
27 | 2xqn:T | 125 | 24 | 0.2333 | 0.0560 | 0.2917 | 7.1 | 2iyb:E, 2iyb:F, 2iyb:G, 2iyb:H |
28 | 1x3h:A | 80 | 30 | 0.3000 | 0.1125 | 0.3000 | 7.3 | |
29 | 5xtc:b | 124 | 16 | 0.2333 | 0.0565 | 0.4375 | 8.1 | 5xtd:b, 5xth:b, 5xti:b, 5xti:Bb |
30 | 2miu:A | 98 | 28 | 0.3667 | 0.1122 | 0.3929 | 8.1 | |
31 | 2dfy:X | 158 | 26 | 0.2667 | 0.0506 | 0.3077 | 9.6 | 2dfy:C, 1rut:X |