MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRNVPAFVSGKALKDAVK
The query sequence (length=71) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4yew:C | 71 | 71 | 1.0000 | 1.0000 | 1.0000 | 4.22e-46 | 6o6k:B, 6oaj:D, 4yex:C, 4yft:C |
2 | 6oaj:B | 79 | 79 | 0.9859 | 0.8861 | 0.8861 | 1.29e-42 | 6o6k:A, 6o8q:A, 6o8q:I, 6oaj:C, 4yey:C, 4yf0:A, 4yfh:A |
3 | 6o8q:B | 91 | 90 | 1.0000 | 0.7802 | 0.7889 | 2.19e-41 | 6o8q:G, 6o8q:H, 6o8q:F, 4yf0:B, 4yfh:B |
4 | 4qju:A | 90 | 90 | 0.5493 | 0.4333 | 0.4333 | 2.80e-18 | 4qju:B |
5 | 1p71:A | 94 | 89 | 0.4789 | 0.3617 | 0.3820 | 4.98e-14 | 1p51:A, 1p51:B, 1p51:D, 1p51:C, 1p71:B, 1p78:A, 1p78:B |
6 | 4dky:B | 101 | 89 | 0.4225 | 0.2970 | 0.3371 | 1.83e-09 | |
7 | 8flj:F | 94 | 90 | 0.3380 | 0.2553 | 0.2667 | 1.38e-07 | 8flj:H |
8 | 2iie:A | 204 | 56 | 0.2535 | 0.0882 | 0.3214 | 6.15e-04 | 2ht0:A, 1ihf:A, 2iif:A, 5j0n:I, 5j0n:K, 1ouz:A, 1owf:A, 1owg:A, 5wfe:K |
9 | 8flj:G | 98 | 60 | 0.2394 | 0.1735 | 0.2833 | 0.013 | 8flj:E |
10 | 8cpl:C | 499 | 19 | 0.1690 | 0.0240 | 0.6316 | 2.5 | 8cpl:A, 8cpl:B, 8cpl:D, 1lp1:B, 4uox:A, 4uox:B, 4uox:C, 4uox:D, 4uoy:A, 4uoy:B, 4uoy:C, 4uoy:D |
11 | 3zxu:A | 211 | 48 | 0.1690 | 0.0569 | 0.2500 | 3.8 | 5mu3:A, 5mu3:D, 3zxu:C |
12 | 2np2:A | 102 | 58 | 0.1831 | 0.1275 | 0.2241 | 4.1 | 2np2:B |
13 | 6nvo:A | 200 | 36 | 0.1690 | 0.0600 | 0.3333 | 9.7 | 6nvp:A |