BioLiP

>protein
MNKDQAEKYQERSLRQKYNLLHVLPTLNSRALSGLYYKNFHNSVKRYQIMLPEQLKSGKFCSHCGCVYVPNGDSDELGGE
SMEGPKKCIQVNCLNCEKSKLFEW

The query sequence (length=104) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7c79:K	104	104	1.0000	1.0000	1.0000	2.92e-75	7c7a:K
2	6w6v:K	79	73	0.6635	0.8734	0.9452	1.72e-47
3	5msy:A	457	36	0.1346	0.0306	0.3889	0.94	5msy:B, 5msy:C
4	1qft:A	175	34	0.1250	0.0743	0.3824	1.1	3g7x:A, 3g7x:B, 1qft:B, 1qfv:A, 1qfv:B
5	6dec:I	209	29	0.0962	0.0478	0.3448	1.4
6	6yw7:B	286	35	0.1058	0.0385	0.3143	2.1	2p9i:B, 2p9k:B, 6yw6:B
7	2x41:A	715	51	0.1442	0.0210	0.2941	3.3	2x42:A
8	8ab7:P	186	32	0.1154	0.0645	0.3750	3.7	8ab7:E, 8ab8:P, 8ab9:P, 8aba:P, 8abb:P, 8abe:P, 8abf:P, 8abg:P, 8abh:P, 8abi:P, 8abj:P, 8abk:P, 8abm:P, 8ac3:P, 8ac4:P, 8ac5:P
9	3c0t:A	201	32	0.1154	0.0597	0.3750	3.7
10	5hmq:D	624	36	0.1058	0.0176	0.3056	5.3	5hmq:A, 5hmq:B, 5hmq:C, 5hmq:E, 5hmq:F
11	7rja:C	181	28	0.1154	0.0663	0.4286	5.4	7rja:M, 7rjb:E, 7rjc:E, 7rjd:E, 7rje:C, 7rje:M
12	8bpx:AD	196	21	0.0865	0.0459	0.4286	8.0	8bel:D, 8bel:N, 8bpx:BD, 8bq5:AD, 8bq5:BD, 8bq6:AD, 8bq6:BD
13	8p94:B	394	29	0.0962	0.0254	0.3448	9.5	6dec:B, 3dxk:B, 4jd2:B, 7jpn:B, 2p9n:B, 2p9p:B, 2p9s:B, 2p9u:B, 7t5q:B, 8tah:B, 7tpt:B, 1tyq:B, 1u2v:B, 6uhc:B, 3ukr:B, 3ule:B
14	8q1b:E	182	32	0.1154	0.0659	0.3750	9.9	8q1b:P

[Back]