BioLiP

>protein
MMTLENVLEAARHLHQTLPALSEFGNWPTDLTATGLQPRAIPATPLVQALDQPGSPRTTGLVQAIRSAAHLAHWKRTYTE
AEVGADFRNRYGYFELFGPTGHFHSTQLRGYVAYWGAGLDYDWHSHQAEELYLTLAGGAVFKVDGERAFVGAEGTRLHAS
WQSHAMSTGDQPILTFVLWRGEGLNALPRMD

The query sequence (length=191) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4la2:B	192	190	0.9948	0.9896	1.0000	1.21e-140	5jso:A, 5jso:B, 5jsp:A, 5jsp:B, 5jsr:A, 5jsr:B, 4la2:A, 4la3:A, 4la3:B
2	4b29:A	195	188	0.4398	0.4308	0.4468	3.78e-46
3	5cu1:A	197	180	0.3351	0.3249	0.3556	4.21e-29
4	3cew:A	118	60	0.1047	0.1695	0.3333	1.9	3cew:B, 3cew:C, 3cew:D
5	8ch4:D	183	56	0.0838	0.0874	0.2857	4.3	8ch4:A, 8ch4:B, 8ch4:C
6	7yoj:A	867	38	0.0785	0.0173	0.3947	7.1
7	8any:A4	595	58	0.0785	0.0252	0.2586	8.4	8oir:Ae, 8ois:Ae, 7po2:4, 7qi4:A4, 7qi5:A4, 7qi6:A4, 6zm5:A4, 6zm6:A4
8	1j3p:A	187	91	0.1257	0.1283	0.2637	8.5	1j3q:A, 1j3q:B, 1j3r:A, 1j3r:B
9	6qx9:1K	201	74	0.1152	0.1095	0.2973	8.8	7b0y:b, 4pjo:K, 4pjo:k, 4pjo:N, 4pjo:n, 8r08:1K, 7vpx:O
10	7ajt:UR	482	35	0.0785	0.0311	0.4286	9.1	7aju:UR, 7d4i:B8, 7d5s:B8, 7d5t:B8, 7d63:B8, 6ke6:B8, 6lqp:B8, 6lqq:B8, 6lqr:B8, 6lqs:B8, 6lqt:B8, 6lqu:B8, 6lqv:B8, 6nd4:S, 7suk:LS, 5wlc:LS, 6zqa:UR, 6zqb:UR, 6zqc:UR, 6zqd:UR
11	4oev:A	494	32	0.0524	0.0202	0.3125	9.3	4oeu:A, 4oeu:B, 4oev:B
12	1o4t:A	115	56	0.0838	0.1391	0.2857	9.9	1o4t:B

[Back]