MMRIGELGKKADCLVQTVRFYESEGLLPEPFRLYDEVHLQRLLFIRRCRAKDMTLDEIRQLLNLRDRPELGCGEVNALVD
AHIAQVRTKMKELRALERELMDLRRSCDSARTSRECGILNSLA
The query sequence (length=123) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5gpe:D | 129 | 129 | 1.0000 | 0.9535 | 0.9535 | 6.88e-84 | 5gpe:A, 5gpe:B, 5gpe:C, 5gpe:E, 5gpe:F, 5gpe:G, 5gpe:H |
2 | 6jni:A | 145 | 127 | 0.5447 | 0.4621 | 0.5276 | 2.07e-41 | 6jgw:B, 6jgw:A, 6jgx:A, 6jgx:B, 6jni:B, 6jni:H, 6jni:C, 6jni:D, 6jni:E, 6jni:F, 6jni:G, 6jyw:A, 6jyw:B |
3 | 4ua1:B | 125 | 125 | 0.3740 | 0.3680 | 0.3680 | 8.43e-19 | 4ua1:A |
4 | 5crl:B | 119 | 121 | 0.3333 | 0.3445 | 0.3388 | 4.55e-14 | |
5 | 4wlw:A | 130 | 128 | 0.2764 | 0.2615 | 0.2656 | 5.14e-12 | 7c17:G, 7c17:H, 6ldi:G, 6ldi:H, 1q05:A, 1q05:B, 4wls:A, 4wls:B, 6xh7:G, 6xh7:H, 6xh8:G, 6xh8:H |
6 | 1q08:A | 94 | 86 | 0.2602 | 0.3404 | 0.3721 | 6.73e-10 | 1q08:B, 1q09:A, 1q0a:A, 1q0a:B |
7 | 3d6y:A | 277 | 104 | 0.2114 | 0.0939 | 0.2500 | 0.44 | 1bow:A, 7ckq:G, 7ckq:I, 3d6z:A, 3d70:A, 3d71:A, 1exi:A, 1exj:A, 3q1m:A, 3q2y:A, 3q3d:A, 3q5p:A, 3q5r:A, 3q5s:A, 1r8e:A |
8 | 3gp4:A | 132 | 69 | 0.1463 | 0.1364 | 0.2609 | 0.79 | 3gp4:B |
9 | 4uvq:A | 263 | 41 | 0.1220 | 0.0570 | 0.3659 | 1.1 | |
10 | 5e2f:A | 237 | 78 | 0.1789 | 0.0928 | 0.2821 | 1.1 | |
11 | 7tea:B | 78 | 61 | 0.1545 | 0.2436 | 0.3115 | 1.2 | 7tea:E, 7tea:A, 7tea:C |
12 | 2zhg:A | 121 | 27 | 0.0813 | 0.0826 | 0.3704 | 1.5 | 2zhh:A |
13 | 8fth:A | 1263 | 60 | 0.1545 | 0.0150 | 0.3167 | 1.7 | |
14 | 7ajt:CM | 360 | 24 | 0.1057 | 0.0361 | 0.5417 | 1.9 | 7aju:CM, 7d4i:RK, 7d5s:RK, 7d5t:RK, 7d63:RK, 6ke6:RK, 6lqp:RK, 6lqq:RK, 6lqr:RK, 6lqs:RK, 6lqt:RK, 6lqu:RK, 6lqv:RK, 7suk:SH, 5wlc:SH, 6zqa:CM, 6zqb:CM, 6zqc:CM, 6zqd:CM, 6zqe:CM, 6zqg:CM |
15 | 5d8c:B | 128 | 51 | 0.1301 | 0.1250 | 0.3137 | 2.2 | 5d8c:A, 5e01:A, 5e01:B |
16 | 2wop:A | 554 | 37 | 0.1220 | 0.0271 | 0.4054 | 3.1 | 2wok:A |
17 | 8idp:A | 446 | 16 | 0.0813 | 0.0224 | 0.6250 | 5.4 | 8idp:C, 8idp:B, 8idp:D, 8idq:A, 8idq:B, 8idq:C, 8idq:D |
18 | 4mvt:A | 255 | 55 | 0.1301 | 0.0627 | 0.2909 | 6.3 | 4mvt:B, 4mvt:C, 4mvt:D |
19 | 7tec:A | 72 | 27 | 0.0732 | 0.1250 | 0.3333 | 8.0 |