Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
MMEYIDGAQIALYAFWLFFFGLIIYLRREDKREGYPLESPQGPRDGWPKGAPKKTYVHRDHG

The query sequence (length=62) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 7o0u:H1 62 62 1.0000 1.0000 1.0000 3.88e-42 7o0v:H1, 7o0w:H1, 7o0x:H1
2 7oy8:H 257 35 0.4516 0.1089 0.8000 2.23e-15
3 1dv6:H 246 37 0.3387 0.0854 0.5676 6.24e-09 8c88:H, 1dv6:T, 2hg3:H, 7od5:H, 1ogv:H, 7p0q:H, 7p17:H, 7p2c:H, 1qov:H, 6z1j:H, 7z8d:H
4 5m7j:D 243 38 0.3065 0.0782 0.5000 1.08e-06 5m7k:D, 5m7l:D
5 6ftj:1 162 18 0.1290 0.0494 0.4444 1.8
6 7v5c:A 572 25 0.1774 0.0192 0.4400 4.3 7v5c:B, 7vfi:A, 7vfi:B
7 4tpg:A 459 34 0.1774 0.0240 0.3235 5.2 4lep:A, 4lep:B, 4tph:A, 4tpj:B, 4tpj:A
8 6hwh:V 550 46 0.2581 0.0291 0.3478 6.6 6hwh:Q
9 6lm1:A 226 41 0.2097 0.0575 0.3171 7.4 6lm1:B, 6lm1:C
10 8c10:A 297 18 0.1452 0.0303 0.5000 8.1
11 6s7o:E 560 18 0.1290 0.0143 0.4444 8.3 6s7t:E
12 3i0p:A 361 25 0.1613 0.0277 0.4000 10.0

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218