MLYLIIYDVPATKAGNKRRTRLFDLLSGYGKWRQFSVFECFLSVKQFAKLQTAMEKLIKLDEDAVCIYVLDENTVQRTIT
YGTPQPEKPGSII
The query sequence (length=93) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7cr8:M | 93 | 93 | 1.0000 | 1.0000 | 1.0000 | 1.41e-66 | 7cr6:E, 7cr6:F, 7cr8:N, 7cr8:U, 7cr8:V, 7cr8:e, 7cr8:f, 7cr8:m, 7cr8:n, 7cr8:u, 7cr8:v, 7cr8:E, 7cr8:F |
2 | 7mi4:E | 95 | 66 | 0.2473 | 0.2421 | 0.3485 | 9.65e-09 | 7mi4:F, 7mi5:E, 7mi5:F, 7mi9:E, 7mi9:F, 7mib:F, 7mib:E, 7mid:C, 7mid:D |
3 | 8d3p:E | 100 | 74 | 0.2903 | 0.2700 | 0.3649 | 1.39e-08 | 8d3l:F, 8d3l:E, 8d3m:F, 8d3m:E, 8d3p:F, 8d3q:F, 8d3q:E |
4 | 6cgs:A | 207 | 51 | 0.1720 | 0.0773 | 0.3137 | 2.0 | 6cgs:B |
5 | 4aw2:A | 398 | 36 | 0.1183 | 0.0276 | 0.3056 | 2.1 | |
6 | 5otf:A | 411 | 32 | 0.1183 | 0.0268 | 0.3438 | 4.4 | 5ote:A, 3qfv:A, 3qfv:B, 3tku:A, 3tku:B, 4uak:A, 4ual:A |
7 | 1i2k:A | 269 | 54 | 0.1613 | 0.0558 | 0.2778 | 4.8 | 1et0:A, 1i2l:A |
8 | 8u9x:A | 1398 | 51 | 0.1720 | 0.0114 | 0.3137 | 4.9 | 6blo:A, 6blp:A, 6bm2:A, 6bm4:A, 6bqf:A, 1i6h:A, 7ked:A, 1nik:A, 1r5u:A, 1r9s:A, 7rim:A, 7rip:A, 7riw:A, 7rix:A, 7riy:A, 8u9r:A, 8ukq:A, 8ukr:A, 8uks:A, 8ukt:A, 8uku:A, 6upx:A, 6upy:A, 6upz:A, 6uq0:A, 6uq1:A, 6uq2:A, 6uq3:A, 5w4u:A, 5w51:A |
9 | 7ebl:B | 167 | 58 | 0.1720 | 0.0958 | 0.2759 | 6.3 | 7ebl:A |
10 | 6ene:A | 329 | 25 | 0.1075 | 0.0304 | 0.4000 | 6.7 | 6ene:C, 6ene:B |
11 | 8pyz:F | 347 | 25 | 0.1075 | 0.0288 | 0.4000 | 7.4 | 5nup:A, 5nup:B, 5nup:C, 5o79:C, 5o79:A, 5o79:B, 8pyz:E, 8pyz:C, 7q3t:A, 7q3t:B, 7q3t:C, 7q3t:E, 7q3t:D, 7q3t:F, 6rck:C, 6rd3:A, 6rd3:B, 6rd3:C, 6rd3:D, 6rd3:E, 6rd3:F, 7szi:C |
12 | 6m0q:A | 504 | 48 | 0.1720 | 0.0317 | 0.3333 | 7.6 | 4fas:A, 4fas:C, 4fas:B, 1fgj:A, 1fgj:B, 6m0p:A, 6m0p:C, 6m0p:E, 6m0q:C, 6m0q:E, 6m0q:G, 6m0q:I, 6m0q:K, 4n4n:A, 4n4n:C, 4n4n:E, 4n4o:A, 4n4o:C, 4n4o:E |
13 | 5ab6:D | 396 | 47 | 0.1505 | 0.0354 | 0.2979 | 9.5 | 5ab6:A, 5ab6:B, 5ab6:C, 5ab6:E, 5ab6:F, 5ab7:A, 5ab7:B, 5ab7:C, 5ab7:D, 5ab7:E, 5ab7:F |