MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDK
The query sequence (length=60) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7n10:A | 60 | 60 | 1.0000 | 1.0000 | 1.0000 | 5.80e-37 | |
2 | 6rm3:LI0 | 216 | 40 | 0.2500 | 0.0694 | 0.3750 | 0.077 | |
3 | 1t8y:F | 461 | 23 | 0.1833 | 0.0239 | 0.4783 | 0.87 | 1t8s:A, 1t8s:B, 1t8s:C, 1t8s:D, 1t8s:E, 1t8s:F, 1t8y:C, 1t8y:B, 1t8y:E, 1t8y:A |
4 | 6tm5:P | 492 | 31 | 0.2167 | 0.0264 | 0.4194 | 1.2 | |
5 | 7cgu:A | 352 | 45 | 0.2167 | 0.0369 | 0.2889 | 2.0 | |
6 | 8b25:B | 359 | 45 | 0.1667 | 0.0279 | 0.2222 | 3.1 | 8b1v:A, 8b1v:B, 8b25:A, 8b26:A, 8b26:B |
7 | 2p20:A | 641 | 17 | 0.1167 | 0.0109 | 0.4118 | 5.4 | 5jrh:A, 5jrh:B, 2p20:B, 2p2b:A, 2p2b:B, 2p2f:A, 2p2f:B, 2p2j:A, 2p2j:B, 2p2m:A, 2p2m:B, 2p2q:A, 2p2q:B, 1pg3:A, 1pg3:B, 1pg4:A, 1pg4:B |
8 | 3q9l:A | 257 | 26 | 0.1667 | 0.0389 | 0.3846 | 5.5 | 3q9l:B, 3r9i:A, 3r9i:B, 3r9i:C, 3r9i:D, 3r9j:A, 3r9j:B |
9 | 3e8x:A | 214 | 41 | 0.2667 | 0.0748 | 0.3902 | 5.8 | |
10 | 3k1u:A | 314 | 19 | 0.1500 | 0.0287 | 0.4737 | 6.0 | |
11 | 8fmw:P | 83 | 20 | 0.1667 | 0.1205 | 0.5000 | 7.2 | |
12 | 3sgi:A | 408 | 31 | 0.2333 | 0.0343 | 0.4516 | 8.4 | 7k72:A, 7k72:B, 7k72:C, 7k72:D, 6kdu:A, 6kjm:A, 6kkv:A, 6krh:A, 6ksc:A, 6ksd:A, 6lw8:A, 1zau:A |