MLSGLNHLTLAVSQLAPSVAFYQQLLGMTLHARWDSGAYLSCGDLWLCLSLDPQRRVTPPEESDYTHYAFSISEADFASF
AARLEAAGVAVWKLNRSEGASHYFLDPDGHKLELHVGSLAQRLAACREQPYKGMVFFE
The query sequence (length=138) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5wew:B | 141 | 138 | 1.0000 | 0.9787 | 1.0000 | 4.04e-101 | 6c3u:A, 6c3u:B, 6c3u:C, 6c3u:D, 8r37:B, 8r37:A, 5v3d:A, 5v3d:B, 5v91:A, 5v91:B, 5wew:A, 5wew:C, 5wew:D, 5wew:F, 5wew:G, 5wew:H |
2 | 5wew:E | 119 | 137 | 0.8623 | 1.0000 | 0.8686 | 4.89e-83 | |
3 | 5vb0:C | 143 | 138 | 0.7971 | 0.7692 | 0.7971 | 1.62e-78 | 5vb0:A, 5vb0:B, 5vb0:D, 5vb0:E, 5vb0:F, 5vb0:G, 5vb0:H, 5wep:A, 5wep:B |
4 | 1lqk:A | 134 | 136 | 0.6449 | 0.6642 | 0.6544 | 7.76e-52 | 1lqk:B, 1lqo:A, 1lqo:B, 1lqp:A, 1lqp:B, 1nki:A, 1nki:B, 1nnr:A, 1nnr:B |
5 | 7n7g:A | 138 | 133 | 0.3623 | 0.3623 | 0.3759 | 9.78e-25 | 7n7g:B |
6 | 8dtd:A | 138 | 143 | 0.3986 | 0.3986 | 0.3846 | 2.00e-24 | 8dtd:B, 8e7q:A, 8e7q:B, 8e7r:A, 8e7r:B, 8g7f:A, 8g7f:B, 8g7g:A, 8g7g:B, 8g7h:A, 8g7h:B, 8g7i:A, 8g7i:B, 4jh1:A, 4jh1:B, 4jh2:A, 4jh2:B, 4jh3:A, 4jh3:B, 4jh4:A, 4jh4:B, 4jh5:A, 4jh5:B, 4jh6:A, 4jh6:B, 4jh7:A, 4jh7:B, 4jh8:A, 4jh8:B, 4jh9:A, 4jh9:B |
7 | 4jd1:B | 148 | 140 | 0.3333 | 0.3108 | 0.3286 | 8.61e-21 | 5f6q:A, 5f6q:B, 4ir0:A, 4ir0:B, 4jd1:A |
8 | 4naz:A | 130 | 140 | 0.3478 | 0.3692 | 0.3429 | 4.53e-19 | 4nay:A, 4nb0:A, 4nb0:B, 4nb1:B, 4nb1:A |
9 | 2p7p:A | 131 | 134 | 0.3261 | 0.3435 | 0.3358 | 8.07e-15 | 2p7o:A, 2p7o:B, 2p7p:B, 2p7p:C, 2p7p:D, 2p7p:E, 2p7p:F, 2p7q:A, 2p7q:B, 2p7q:C, 2p7q:D, 2p7q:E, 2p7q:F |
10 | 1r9c:A | 125 | 131 | 0.2754 | 0.3040 | 0.2901 | 1.49e-11 | 1r9c:B |
11 | 6a4x:A | 127 | 124 | 0.2536 | 0.2756 | 0.2823 | 1.29e-09 | |
12 | 8he6:B | 120 | 124 | 0.2609 | 0.3000 | 0.2903 | 2.01e-08 | |
13 | 3l7t:B | 133 | 133 | 0.2754 | 0.2857 | 0.2857 | 3.56e-05 | |
14 | 6a4z:A | 127 | 122 | 0.2319 | 0.2520 | 0.2623 | 3.27e-04 | 6a4z:B, 7w5e:A, 7w5e:B, 7w5e:C, 7w5e:D, 7wb2:A, 7wb2:B, 7wb2:C, 7wb2:D |
15 | 6a52:B | 125 | 58 | 0.1304 | 0.1440 | 0.3103 | 0.003 | 6a52:A |
16 | 2c21:A | 139 | 117 | 0.2246 | 0.2230 | 0.2650 | 0.027 | 2c21:B, 2c21:C, 2c21:D, 2c21:E, 2c21:F |
17 | 1kmy:A | 288 | 124 | 0.2536 | 0.1215 | 0.2823 | 0.044 | 1han:A, 1knd:A, 1knf:A, 1lgt:A, 1lkd:A |
18 | 3ct8:A | 133 | 123 | 0.2246 | 0.2331 | 0.2520 | 0.060 | |
19 | 3bga:A | 1003 | 14 | 0.0725 | 0.0100 | 0.7143 | 0.17 | 3bga:B |
20 | 6qh4:C | 138 | 27 | 0.0942 | 0.0942 | 0.4815 | 0.18 | 6qh4:A, 6qh4:B, 6qh4:D, 3rmu:A, 3rmu:B, 3rmu:C, 3rmu:D |
21 | 3kol:A | 146 | 134 | 0.2536 | 0.2397 | 0.2612 | 0.31 | |
22 | 4mtt:A | 128 | 121 | 0.2319 | 0.2500 | 0.2645 | 0.60 | 4mtr:A, 4mtr:B, 4mts:B, 4mtt:B |
23 | 7q4a:B | 346 | 20 | 0.0942 | 0.0376 | 0.6500 | 0.83 | 7q4a:A |
24 | 8jze:a | 670 | 101 | 0.2391 | 0.0493 | 0.3267 | 1.3 | 8jzf:a |
25 | 3hpv:A | 297 | 118 | 0.2101 | 0.0976 | 0.2458 | 2.4 | 3hpv:B, 3hpv:C, 3hpv:D, 3hpy:A, 3hpy:B, 3hpy:C, 3hpy:D, 3hq0:A, 3hq0:B, 3hq0:C, 3hq0:D |
26 | 1fa5:A | 128 | 124 | 0.2391 | 0.2578 | 0.2661 | 2.6 | 1fa5:B, 1fa6:A, 1fa6:B |
27 | 3oxh:A | 251 | 33 | 0.0942 | 0.0518 | 0.3939 | 3.8 | |
28 | 1f1u:A | 322 | 14 | 0.0580 | 0.0248 | 0.5714 | 6.8 | 1f1r:A, 1f1r:B, 1f1u:B, 1f1v:A, 1f1v:B |
29 | 7pog:A | 2382 | 77 | 0.1522 | 0.0088 | 0.2727 | 9.4 | 4dmw:A, 3ho6:A, 3ho6:B, 4r04:A, 3srz:A, 3ss1:A, 7u2p:A, 7uby:B, 7uby:A, 5uqk:A, 5uql:A |