MLQKKIEEIAAKYKHSVVKKCCYDGASVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMC
The query sequence (length=71) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5hcc:A | 982 | 69 | 0.9577 | 0.0692 | 0.9855 | 1.20e-42 | 7ad6:A, 8ayh:A, 1cfa:A, 5hcd:A, 5hce:A |
2 | 4wb2:C | 74 | 69 | 0.6056 | 0.5811 | 0.6232 | 4.30e-28 | 4wb2:A, 4wb3:A, 4wb3:C |
3 | 8cem:B | 974 | 63 | 0.3380 | 0.0246 | 0.3810 | 1.46e-05 | |
4 | 1yht:A | 344 | 30 | 0.1690 | 0.0349 | 0.4000 | 0.77 | |
5 | 5och:C | 537 | 31 | 0.1549 | 0.0205 | 0.3548 | 0.83 | |
6 | 5och:E | 576 | 31 | 0.1549 | 0.0191 | 0.3548 | 0.83 | 7ehl:A, 7ehl:B, 5och:A, 5och:B, 5och:D, 5och:F, 5och:G, 5och:H |
7 | 5okl:B | 558 | 21 | 0.1127 | 0.0143 | 0.3810 | 3.4 | |
8 | 6rq7:B | 479 | 21 | 0.1127 | 0.0167 | 0.3810 | 3.6 | |
9 | 2vyc:A | 755 | 38 | 0.2113 | 0.0199 | 0.3947 | 4.2 | 2vyc:B, 2vyc:C, 2vyc:D, 2vyc:E, 2vyc:F, 2vyc:G, 2vyc:H, 2vyc:I, 2vyc:J |
10 | 6hsj:B | 390 | 34 | 0.1972 | 0.0359 | 0.4118 | 7.0 | 6hsp:B |