MLPGTFFEVLKNEGVVAIATQGEDGPHLVNTWDSYLKVLDGNRIVVPVGGMHKTEANVARDERVLMTLGSRKVAGRNGPG
TGFLIRGSAAFRTDGPEFEAIARFKWARAALVITVVSAEQTL
The query sequence (length=122) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 3a20:A | 122 | 121 | 0.9836 | 0.9836 | 0.9917 | 1.86e-85 | 3a20:B, 3a6q:A, 3a6q:B, 3a6r:A, 3a6r:B, 3a6r:C, 3a6r:D, 3amf:A, 3amf:B, 3awh:A, 3awh:B, 1axj:A, 2e83:A, 2e83:B, 1flm:A, 1flm:B, 3vy2:A, 3vy2:B, 3vy5:A, 3vy5:B, 3vya:A, 1wli:A, 1wli:B, 1wlk:A, 1wlk:B, 1wlk:C, 1wlk:D |
| 2 | 7eg5:A | 125 | 125 | 0.4016 | 0.3920 | 0.3920 | 2.43e-25 | 7eg5:B |
| 3 | 3j7a:C | 195 | 77 | 0.1721 | 0.1077 | 0.2727 | 0.40 | 3jbn:C, 3jbo:C, 3jbp:C, 6okk:C, 8tpu:SC |
| 4 | 2zpa:B | 662 | 72 | 0.1803 | 0.0332 | 0.3056 | 3.8 | 2zpa:A |
| 5 | 4r2w:D | 251 | 90 | 0.1885 | 0.0916 | 0.2556 | 4.6 | 7q2w:FFF, 4r2w:A, 4r2w:B, 4r2w:C, 4r2w:E, 4r2w:F, 4r2x:C, 4r2x:D, 4r2x:E, 4r2x:F, 4r2x:A, 4r2x:B, 4yjk:D, 4yjk:F, 4yjk:A |
| 6 | 4neh:A | 1084 | 25 | 0.0820 | 0.0092 | 0.4000 | 7.3 | 5es4:A, 3k6s:A, 3k71:G |
| 7 | 4nen:A | 1063 | 25 | 0.0820 | 0.0094 | 0.4000 | 7.7 | |
| 8 | 3k6s:C | 885 | 25 | 0.0820 | 0.0113 | 0.4000 | 7.8 | 5es4:C, 5es4:E, 5es4:G, 3k6s:E, 3k6s:G, 3k71:A, 3k71:C, 3k71:E, 3k72:A, 3k72:C |
| 9 | 6h57:A | 795 | 25 | 0.0902 | 0.0138 | 0.4400 | 8.5 | |
| 10 | 7aju:JD | 811 | 25 | 0.0902 | 0.0136 | 0.4400 | 8.5 | 6zqd:JD, 6zqe:JD, 6zqf:JD |
| 11 | 6zqg:JD | 829 | 25 | 0.0902 | 0.0133 | 0.4400 | 8.5 | |
| 12 | 7d63:RZ | 839 | 25 | 0.0902 | 0.0131 | 0.4400 | 8.5 | 7d4i:RZ, 7d5t:RZ, 7mqj:A |
umich.edu