MLKLNLKKSFQKDFDKLLLNGFDDSVLNEVILTLRKKEPLDPQFQDHALKGKWKPFRECHIKPDVSLVYLVKDDELILLR
LGSHSELF
The query sequence (length=88) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4lsy:B | 88 | 88 | 1.0000 | 1.0000 | 1.0000 | 8.16e-59 | |
2 | 4nrn:A | 90 | 90 | 0.5341 | 0.5222 | 0.5222 | 5.23e-25 | 4nrn:B |
3 | 19hc:A | 292 | 71 | 0.2273 | 0.0685 | 0.2817 | 0.45 | 19hc:B, 1ofw:A, 1ofw:B, 1ofy:A, 1ofy:B |
4 | 4irn:A | 378 | 30 | 0.1591 | 0.0370 | 0.4667 | 0.53 | 4irn:B, 4irn:C, 4irn:D, 4irn:E, 4irn:F, 4irn:G, 4irn:H |
5 | 8e2c:A | 65 | 65 | 0.1932 | 0.2615 | 0.2615 | 0.66 | |
6 | 4yd9:A | 1656 | 47 | 0.1705 | 0.0091 | 0.3191 | 6.5 | 4yd9:D, 4yd9:G, 4yd9:J, 4yd9:M, 4yd9:P, 4yd9:S, 4yd9:V, 4yd9:Y, 4yd9:b |
7 | 5dbj:E | 437 | 40 | 0.1591 | 0.0320 | 0.3500 | 8.1 | 5dbj:A, 5dbj:B, 5dbj:C, 5dbj:D |
8 | 4yd9:B | 825 | 70 | 0.2386 | 0.0255 | 0.3000 | 8.4 | 4yd9:E, 4yd9:H, 4yd9:K, 4yd9:N, 4yd9:Q, 4yd9:T, 4yd9:W, 4yd9:Z, 4yd9:c |
9 | 8eug:D | 287 | 45 | 0.1477 | 0.0453 | 0.2889 | 9.2 | 8eui:D |