MLILTRRVGETLMVGDDVTVTVLGVKGNQVRIGVNAPKEVAVHREEIYQRIQKEK
The query sequence (length=55) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7yr6:E | 55 | 55 | 1.0000 | 1.0000 | 1.0000 | 6.94e-34 | 7yr6:D, 7yr6:C, 7yr6:B, 7yr7:F, 7yr7:E, 7yr7:G, 7yr7:B, 7yr7:C, 7yr7:D |
2 | 2mf0:A | 59 | 52 | 0.7273 | 0.6780 | 0.7692 | 2.13e-26 | 2jpp:A, 2jpp:B, 2mf0:B, 2mf0:C, 2mf0:D, 2mf0:E, 2mf0:F, 2mf1:A, 2mf1:B, 2mf1:C, 2mf1:D, 2mf1:E, 2mf1:F, 2mfc:A, 2mfc:C, 2mfe:A, 2mfe:C, 2mff:A, 2mff:C, 2mfg:A, 2mfg:C, 2mfh:A, 2mfh:C |
3 | 4kji:B | 65 | 63 | 0.3818 | 0.3231 | 0.3333 | 0.009 | 4kji:A |
4 | 4rk9:A | 384 | 31 | 0.1818 | 0.0260 | 0.3226 | 1.7 | 4rk9:B |
5 | 3v0r:A | 130 | 27 | 0.1818 | 0.0769 | 0.3704 | 2.6 | |
6 | 8r3r:A | 658 | 27 | 0.2000 | 0.0167 | 0.4074 | 4.2 | 8r3r:B, 8r3r:C, 8r3r:D |
7 | 3jce:x | 586 | 30 | 0.2364 | 0.0222 | 0.4333 | 4.8 | 3deg:C |
8 | 4zoh:B | 274 | 39 | 0.2727 | 0.0547 | 0.3846 | 5.1 | |
9 | 2idv:A | 177 | 37 | 0.2182 | 0.0678 | 0.3243 | 5.3 | |
10 | 7t7u:C | 70 | 15 | 0.1818 | 0.1429 | 0.6667 | 5.7 | |
11 | 8fia:A | 1772 | 20 | 0.1818 | 0.0056 | 0.5000 | 5.9 |