MLDRIASIKKAPDEEYYVPGHRTCAGCGPALTYRLVAKAAGPNTIFIGPTGCMYVANTSYGCGPWRVPWIHAQITNGGAV
ASGIEAAYKAMIRKKKTDAEFPNIIVMAGDGGAVDIGLQALSAMLYRGHDVLFICYDNESYANTGIQTSPTTPYGANTTF
TPPGEVVPEGKKLFPKDNPKVIAHGHPELKYVATASIGWPVDLMNKVRKGLNQEGPAYIHIHAPCPKGWQFPADKTIEMA
KLAVQTGMFQLYEYENGEYKLSVKVDKRKPVSEYMKLQKRFAHLKPEHIAKMQAFVDARCAEVGITVPVV
The query sequence (length=310) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5exe:C | 314 | 310 | 1.0000 | 0.9873 | 1.0000 | 0.0 | 5c4i:C, 5c4i:F, 5exd:C, 5exd:F, 5exd:I, 5exd:L, 5exe:F |
2 | 1b0p:A | 1231 | 216 | 0.2194 | 0.0552 | 0.3148 | 1.89e-15 | 1b0p:B, 2c3m:A, 2c3m:B, 2c3o:A, 2c3o:B, 2c3p:A, 2c3p:B, 2c3u:A, 2c3u:B, 2c3y:A, 2c3y:B, 2c42:A, 2c42:B, 1kek:A, 1kek:B, 2pda:A, 2pda:B, 2uza:A, 2uza:B |
3 | 7plm:A | 1177 | 213 | 0.2161 | 0.0569 | 0.3146 | 3.38e-15 | 7plm:B |
4 | 6cin:B | 1169 | 226 | 0.2065 | 0.0547 | 0.2832 | 2.45e-10 | 6cin:A, 6cin:C, 6cin:D, 6cin:E, 6cin:F, 6cio:A, 6cio:B, 6cio:C, 6cio:D, 6cio:E, 6cio:F, 6cip:A, 6cip:B, 6cip:C, 6cip:D, 6cip:E, 6cip:F, 6ciq:A, 6ciq:B, 6ciq:C |
5 | 6cin:B | 1169 | 44 | 0.0484 | 0.0128 | 0.3409 | 6.0 | 6cin:A, 6cin:C, 6cin:D, 6cin:E, 6cin:F, 6cio:A, 6cio:B, 6cio:C, 6cio:D, 6cio:E, 6cio:F, 6cip:A, 6cip:B, 6cip:C, 6cip:D, 6cip:E, 6cip:F, 6ciq:A, 6ciq:B, 6ciq:C |
6 | 6n2n:B | 291 | 209 | 0.1774 | 0.1890 | 0.2632 | 2.32e-07 | 6n2n:D, 6n2o:B, 6n2o:D |
7 | 5b46:B | 301 | 206 | 0.1645 | 0.1694 | 0.2476 | 8.64e-05 | |
8 | 5b47:B | 275 | 244 | 0.1839 | 0.2073 | 0.2336 | 2.16e-04 | |
9 | 1jvz:A | 152 | 36 | 0.0355 | 0.0724 | 0.3056 | 3.6 | |
10 | 6a0q:B | 315 | 64 | 0.0613 | 0.0603 | 0.2969 | 4.7 | |
11 | 4q52:A | 175 | 50 | 0.0581 | 0.1029 | 0.3600 | 6.2 | 4q52:B, 4q52:D |
12 | 3pvc:A | 635 | 66 | 0.0710 | 0.0346 | 0.3333 | 6.3 | 3sgl:A |
13 | 7nsn:A | 1371 | 85 | 0.0871 | 0.0197 | 0.3176 | 6.4 | 7nsn:B |
14 | 3fq7:A | 427 | 60 | 0.0645 | 0.0468 | 0.3333 | 10.0 | 3fq7:B, 3fq8:A, 3fq8:B, 3fqa:A, 3fqa:B, 2gsa:A, 2gsa:B, 3gsb:A, 3gsb:B, 4gsa:A, 4gsa:B, 2hoz:A, 2hoz:B, 2hp1:A, 2hp2:A, 2hp2:B, 3usf:A |