MLDITTITRQNVTSVVGFTSWQGTGAEALGLSGDVESARFKELLVGEIDTFTHMQRHKKERLGYDLTFSAPKGVSMQALI
HGDKTIIEAHEKAVAAAVREAEKLAQARTTRQGKSVTQNTNNLVVATFRHETSRLDPDLHTHAFVMNMTQREDGQWRALK
NDELMRNKMHLGDVYKQELALELTKAGYELRYNSKNNTFDMAH
The query sequence (length=203) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8a1c:A | 301 | 221 | 1.0000 | 0.6744 | 0.9186 | 2.77e-144 | 8a1b:A, 3l57:A, 3l57:B, 3l6t:A |
2 | 1zm5:A | 293 | 224 | 0.5616 | 0.3891 | 0.5089 | 1.65e-70 | 2cdm:A, 2cdm:C, 1omh:A, 1osb:A, 1osb:C, 4pcb:A, 4pcb:C, 1qx0:A, 1s6m:A |
3 | 5n8o:A | 1432 | 196 | 0.4039 | 0.0573 | 0.4184 | 1.65e-39 | 4l0j:A, 1p4d:A, 1p4d:B, 1p4d:C, 2q7t:A, 2q7t:B, 2q7u:A |
4 | 2a0i:A | 293 | 196 | 0.3941 | 0.2730 | 0.4082 | 1.47e-38 | |
5 | 1ckq:A | 261 | 78 | 0.1034 | 0.0805 | 0.2692 | 4.8 | 1cl8:A, 1eri:A, 2oxv:A, 1qps:A, 1qrh:A, 1qri:A |
6 | 7oik:A | 4426 | 81 | 0.1084 | 0.0050 | 0.2716 | 6.7 | 7oim:A, 6tax:A, 6tay:A |
7 | 8d32:A | 186 | 32 | 0.0542 | 0.0591 | 0.3438 | 8.4 | 6wgs:A, 6wgv:A, 6wh5:A, 6wh5:B, 6wh5:C |
8 | 6f9p:B | 289 | 38 | 0.0640 | 0.0450 | 0.3421 | 9.3 |