BioLiP

>protein
MKVKQLEDAVEELLSANYHLENAVARLKKLV

The query sequence (length=31) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3crp:B	34	31	1.0000	0.9118	1.0000	2.15e-15	2b1f:A, 2b1f:C, 3crp:C
2	1ysa:C	57	31	0.8065	0.4386	0.8065	2.30e-11	1dgc:A, 2dgc:A, 1ysa:D
3	3i5c:B	198	30	0.8065	0.1263	0.8333	1.92e-10	3i5c:A, 1ij0:A, 1ij0:B, 1ij0:C, 1ij1:A, 1ij1:B, 1ij1:C, 3k7z:A, 3k7z:B, 1rb4:A, 1rb4:B, 1swi:C, 6xne:C
4	1llm:C	87	26	0.7419	0.2644	0.8846	2.42e-09	1llm:D
5	5apw:B	64	29	0.7742	0.3750	0.8276	2.55e-09
6	5apw:B	64	29	0.7419	0.3594	0.7931	8.40e-09
7	1uo4:B	31	29	0.5484	0.5484	0.5862	2.80e-06	1uo5:A
8	1uny:B	30	30	0.5484	0.5667	0.5667	3.11e-06
9	1fav:A	78	26	0.4839	0.1923	0.5769	4.73e-06	6j5e:G, 6tvq:AaA, 6tvu:AaA, 6tvw:CCC, 3vgx:C, 3vu5:A, 3vu6:A, 3w19:C, 5yb4:E, 5yb4:F, 5yb4:D
10	2bni:C	34	30	0.4839	0.4412	0.5000	8.39e-06	2bni:D, 1u9h:A
11	1czq:A	45	30	0.4516	0.3111	0.4667	1.21e-04	1gzl:A, 1gzl:B, 3l35:A, 3l35:C, 3l35:B, 3l36:A, 3l37:A, 3mgn:D, 3mgn:F, 3mgn:A, 3mgn:C, 3mgn:E, 3mgn:B, 6psa:A, 2q3i:A, 2r3c:A, 2r3c:B, 2r5b:A, 2r5b:C, 2r5b:B, 2r5d:A, 2r5d:C, 2r5d:B
12	2r2v:C	33	31	0.4839	0.4545	0.4839	0.007	2r2v:D
13	4hjb:C	30	20	0.3548	0.3667	0.5500	0.018	4hjb:D
14	6lyh:A	358	24	0.3548	0.0307	0.4583	0.68	6lyh:B, 6lyh:C, 6lyh:D, 6lyh:E, 6lyh:F, 6lyh:G, 6lyh:H
15	8tj5:0	1246	17	0.3226	0.0080	0.5882	1.7	8tj5:Y
16	3w8v:A	32	30	0.4839	0.4688	0.5000	2.9	3w8v:B, 3w92:A, 3w92:B, 3w92:C, 3w93:A, 3w93:B, 3w93:C

[Back]