BioLiP

>protein
MKTPEDCTGLADIREAIDRIDLDIVQALGRRMDYVKAASRFPAPERVAAMLPERARWAEENGLDAPFVEGLFAQIIHWYI
AEQIK

The query sequence (length=85) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2h9d:D	100	92	1.0000	0.8500	0.9239	4.37e-56	2h9c:A, 2h9c:B, 2h9d:B, 2h9d:C, 3hgw:D, 3hgx:A, 3rem:A, 3rem:B, 3ret:B
2	2h9d:A	84	85	0.9647	0.9762	0.9647	5.51e-54
3	1jkf:A	466	48	0.2000	0.0365	0.3542	0.99	1jkf:B
4	1p1i:B	498	48	0.2000	0.0341	0.3542	1.00	1p1h:B, 1p1h:D
5	1jki:A	525	48	0.2000	0.0324	0.3542	1.00	1jki:B, 1la2:A, 1la2:B, 1la2:C, 1la2:D, 1p1h:A, 1p1h:C, 1p1i:A, 1p1j:A, 1p1j:B, 1p1k:A, 1p1k:B, 1rm0:A, 1rm0:B
6	4ll2:B	224	40	0.1529	0.0580	0.3250	2.5	4oei:A, 4oei:B, 3s18:A, 3s18:B, 3v6n:A, 3v6n:B, 4yeh:A, 4yeh:B
7	5jhx:A	735	52	0.1882	0.0218	0.3077	2.7	5cjh:A, 5cjh:B, 5jhx:B, 5jhy:A, 5jhy:B, 5jhz:A, 5jhz:B, 3ut2:A, 3ut2:B
8	3ea0:B	242	49	0.2118	0.0744	0.3673	2.9	3ea0:A
9	3aib:G	844	24	0.1294	0.0130	0.4583	7.9	3aib:A, 3aib:B, 3aib:C, 3aib:D, 3aib:E, 3aib:F, 3aib:H, 3aic:A, 3aic:B, 3aic:C, 3aic:D, 3aic:E, 3aic:F, 3aic:G, 3aic:H, 3aie:A, 3aie:B, 3aie:C, 3aie:D, 3aie:E, 3aie:F, 3aie:G, 3aie:H, 8fg8:A, 8fg8:B, 8fj9:A, 8fj9:B, 8fjc:A, 8fjc:B, 8fk4:A, 8fk4:B, 8fk4:C, 8fk4:D, 8fk4:E, 8fk4:F, 8fk4:G, 8fk4:H, 8uf5:A, 8uf5:B
10	1qjs:A	408	22	0.1059	0.0221	0.4091	9.3	1qhu:A, 1qjs:B

[Back]