BioLiP

>protein
MKTPEDCTGLADIREAIDRIDLDIVQALGRRMDYVKAASRFIPAPERVAAMLPERARWAEENGLDAPFVEGLFAQIIHWY
IAEQIKYWRQT

The query sequence (length=91) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2h9d:D	100	97	1.0000	0.9100	0.9381	1.89e-61	2h9c:A, 2h9c:B, 2h9d:B, 2h9d:C, 3hgw:D, 3hgx:A, 3rem:A, 3rem:B, 3ret:B
2	2h9d:A	84	88	0.9231	1.0000	0.9545	5.28e-56
3	4ll2:B	224	40	0.1538	0.0625	0.3500	0.44	4oei:A, 4oei:B, 3s18:A, 3s18:B, 3v6n:A, 3v6n:B, 4yeh:A, 4yeh:B
4	7tlm:A	415	34	0.1209	0.0265	0.3235	1.5	7tlp:B, 7tlp:C, 7tlp:D, 7tlp:E, 7tlp:F, 7tlq:A, 7tlq:B, 7tlr:A, 7tlr:B
5	3ea0:B	242	49	0.1648	0.0620	0.3061	1.6	3ea0:A
6	7tlp:A	391	34	0.1209	0.0281	0.3235	1.7
7	7stm:A	801	49	0.1429	0.0162	0.2653	5.2	7stm:B, 7stn:A, 7stn:B, 7sto:B, 7sto:A
8	3rss:A	494	33	0.1099	0.0202	0.3030	8.2	2ax3:A, 3rrb:A, 3rre:A, 3rrf:A, 3rrj:A, 3rs8:A, 3rs9:A, 3rsf:A, 3rsg:A, 3rsq:A, 3rt7:A, 3rt9:A, 3rta:A, 3rtb:A, 3rtc:A, 3rtd:A, 3rte:A, 3rtg:A, 3ru2:A, 3ru3:A
9	7mr4:C	1083	29	0.0879	0.0074	0.2759	9.8
10	8b1t:C	1080	29	0.0879	0.0074	0.2759	9.9	8b1u:C, 1w36:F
11	3k70:C	1121	29	0.0879	0.0071	0.2759	10.0	3k70:F, 5ld2:C, 7mr3:C, 6sjb:C, 6sje:C, 6sjf:C, 6sjg:C, 6t2u:C, 6t2v:C, 1w36:C

[Back]