MKTPEDCTGLADIREAIDRIDLDIVQALGRRMDYVKAASRFAPERVAAMLPERARWAEENGLDAPFVEGLFAQIIHWYIA
EQIKYWRQ
The query sequence (length=88) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 2h9d:D | 100 | 96 | 1.0000 | 0.8800 | 0.9167 | 9.70e-59 | 2h9c:A, 2h9c:B, 2h9d:B, 2h9d:C, 3hgw:D, 3hgx:A, 3rem:A, 3rem:B, 3ret:B |
| 2 | 2h9d:A | 84 | 86 | 0.9545 | 1.0000 | 0.9767 | 2.91e-56 | |
| 3 | 3ea0:B | 242 | 48 | 0.2045 | 0.0744 | 0.3750 | 1.2 | 3ea0:A |
| 4 | 7jqh:A | 313 | 58 | 0.1818 | 0.0511 | 0.2759 | 3.1 | 7jqi:A, 7jqj:A, 6ovl:A, 6oxn:A, 6p35:A |
| 5 | 7aor:z | 1071 | 40 | 0.1818 | 0.0149 | 0.4000 | 3.2 | |
| 6 | 4ll2:B | 224 | 40 | 0.1477 | 0.0580 | 0.3250 | 4.3 | 4oei:A, 4oei:B, 3s18:A, 3s18:B, 3v6n:A, 3v6n:B, 4yeh:A, 4yeh:B |
| 7 | 6ywe:3 | 95 | 26 | 0.1250 | 0.1158 | 0.4231 | 5.0 | 6yws:3, 6ywv:3, 6ywx:3, 6ywy:3 |
| 8 | 3bm3:A | 259 | 42 | 0.1591 | 0.0541 | 0.3333 | 7.8 | 3bm3:B |
| 9 | 6hiv:Cv | 1059 | 41 | 0.1705 | 0.0142 | 0.3659 | 8.0 | 6hiw:Cv, 6hiy:Cv, 7pub:Cv |
| 10 | 2wtn:B | 250 | 41 | 0.1818 | 0.0640 | 0.3902 | 8.8 | 2wtn:A |
| 11 | 2o5c:A | 634 | 31 | 0.1364 | 0.0189 | 0.3871 | 9.5 | 1i7d:A, 2o19:A, 2o19:B, 2o54:A, 2o54:B, 2o59:A, 2o59:B, 2o5c:B, 2o5e:A, 2o5e:B |
| 12 | 3aib:G | 844 | 24 | 0.1250 | 0.0130 | 0.4583 | 9.5 | 3aib:A, 3aib:B, 3aib:C, 3aib:D, 3aib:E, 3aib:F, 3aib:H, 3aic:A, 3aic:B, 3aic:C, 3aic:D, 3aic:E, 3aic:F, 3aic:G, 3aic:H, 3aie:A, 3aie:B, 3aie:C, 3aie:D, 3aie:E, 3aie:F, 3aie:G, 3aie:H, 8fg8:A, 8fg8:B, 8fj9:A, 8fj9:B, 8fjc:A, 8fjc:B, 8fk4:A, 8fk4:B, 8fk4:C, 8fk4:D, 8fk4:E, 8fk4:F, 8fk4:G, 8fk4:H, 8uf5:A, 8uf5:B |
umich.edu